KEGG   Rahnella aquatilis HX2: Q7S_15880Help
Entry
Q7S_15880         CDS       T01850                                 

Definition
dihydrolipoamide succinyltransferase (EC:2.3.1.61)
Orthology
K00658  
2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
raa  Rahnella aquatilis HX2
Pathway
Citrate cycle (TCA cycle)
Lysine degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Citrate cycle (TCA cycle, Krebs cycle)
Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:raa00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Q7S_15880
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    Q7S_15880
  Amino acid metabolism
   00310 Lysine degradation
    Q7S_15880
Enzymes [BR:raa01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.61  dihydrolipoyllysine-residue succinyltransferase
     Q7S_15880
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3464555..3465784)
Genome map
AA seq 409 aa AA seqDB search
MSSVDILVPDLPESVADATVATWHKKPGDSVERDDVLVEIETDKVVLEVPASEAGILDSI
IEDEGATVISRQILARIRPGNSSGKPSTEKSSDKEATPAARHTAALEEENNDALSPAIRR
LIAEHSLDASAIKGSGVGGRLTREDIEQHLAKAKDAKPAAAPAAAPAATSAAPALGSRSE
KRVPMTRLRKRVAERLLEAKNSTAMLTTFNEINMKPIMDLRKQYGDGFEKRHGVRLGFMS
FYLKAVVEALKRYPEVNASIDGEDVVYHNYFDVSIAVSTPRGLVTPVLRDVDTLGMADIE
KQIKELAIKGRDGKLKVEELTGGNFTVTNGGVFGSLMSTPIINPPQSAILGMHAIKDRPM
AVNGQVVILPMMYLALSYDHRLVDGRESVGFLVTIKEMLEDPARLLLDV
NT seq 1230 nt NT seq  +upstreamnt  +downstreamnt
atgagtagcgtagatattctggtccctgaccttcctgaatccgttgcggatgcgacggtt
gccacctggcacaaaaagccgggcgacagtgttgagcgtgacgatgtactggtagaaatt
gaaaccgacaaagtggttctggaagtcccggcgagtgaagccggtatcctggacagcatt
atcgaagacgaaggtgcgacggtcatttcccgtcagatcctggcgcgtattcgtccgggt
aacagcagcggtaagccaagcactgagaaaagctccgataaagaagcgactcctgcggca
cgccacacagcagcactggaagaagagaacaacgacgcactcagcccggctatccgccgc
ctgattgcagaacattctctggatgccagcgcgattaaaggcagcggtgttggtggtcgt
ctgacccgtgaagatatcgaacagcatctggcgaaagccaaagacgcgaaaccggcagcc
gcgccagccgccgcgccggcagcgaccagcgccgctccggctctgggttcacgtagcgaa
aaacgtgtgcctatgacccgtctgcgtaagcgtgttgctgagcgtctgcttgaagcgaag
aacagcactgcgatgctgacgaccttcaacgaaatcaacatgaagccaatcatggatctg
cgtaagcagtacggtgatggttttgaaaaacgtcacggcgtgcgtctgggcttcatgtct
ttctatctgaaagccgtggttgaagcgctgaaacgctatccggaagtgaacgcgtctatt
gacggcgaggatgtggtttaccacaactatttcgatgtcagcatcgcggtatccacgcca
cgcggcctggtgaccccggttctgcgtgatgtcgatacgctgggcatggcggatatcgag
aagcaaatcaaagagctggcgatcaaaggccgtgacggcaaactgaaagtggaagaactg
accggcggtaactttactgtgaccaacggcggcgtcttcggctccctgatgtccacgcca
atcatcaacccaccacagagtgcgatcctcggcatgcatgccattaaagatcgtcctatg
gcggtcaatggtcaggtagtgattttgccaatgatgtatctggcgctgtcctacgatcac
cgtctggttgatggccgtgaatcggtcggcttcctggtgaccattaaagagatgctggaa
gatccggctcgtctgctgctggacgtctag

DBGET integrated database retrieval system