KEGG   Rahnella aquatilis HX2: Q7S_16080Help
Entry
Q7S_16080         CDS       T01850                                 

Gene name
asnB
Definition
(GenBank) asparagine synthetase B
  KO
K01953  asparagine synthase (glutamine-hydrolysing) [EC:6.3.5.4]
Organism
raa  Rahnella aquatilis HX2
Pathway
raa00250  Alanine, aspartate and glutamate metabolism
raa01100  Metabolic pathways
raa01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:raa00001]
 Metabolism
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    Q7S_16080 (asnB)
Enzymes [BR:raa01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.4  asparagine synthase (glutamine-hydrolysing)
     Q7S_16080 (asnB)
Peptidases [BR:raa01002]
 Cysteine Peptidases
  Family C44
   Q7S_16080 (asnB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Asn_synthase GATase_7 GATase_6 DUF3700 NAD_synthase tRNA_Me_trans
Motif
Other DBs
NCBI-ProteinID: AFE59429
UniProt: H8NW29
Position
3515255..3516919
Genome map
AA seq 554 aa AA seqDB search
MCSIFGVLDIKTDAVELRKKALELSRLMRHRGPDWSGVFASDKAILSHERLSIVDVNNGA
QPLYNAAHTHVLAVNGEIYNHQALRAELGDKYEFQTASDCEVILALYQEKGPAFLDELQG
MFAFILYDTEKDAYLIGRDHLGIIPLYMGYDEHGNMYVASEMKALVPVCRTIKEFPAGSY
LWSQDGEIREYYQRDWFDFENVKDNVTDAAALKDALEEAVKSHLMSDVPYGVLLSGGLDS
SVISAITKKFAGRRIEDKDQSEAWWPQLHSFAVGLQGSPDLRAAQEVANHLGTVHHEIHF
TVQEGLDAIRDVIYHIETYDVTTIRASTPMYLMSRKIKAMGIKMVLSGEGADEVLGGYLY
FHKAPNAKEFHEETVRKLLALHMYDCARANKAMSAWGVEARVPFLDKKFLDVAMRINPKD
KMCGNGKMEKHILRECFESYLPHSVAWRQKEQFSDGVGYSWIDTLKEVASQQITDQQLET
AHFRFPYNTPTSKEGYLYRTIFEELFPVPSAAECVPGGPSVACSSAKAIEWDEAFKNMDD
PSGRAVGVHQSAYK
NT seq 1665 nt NT seq  +upstreamnt  +downstreamnt
atgtgttcaattttcggtgtgctcgatatcaaaactgacgctgtcgagctgcgcaaaaaa
gcgctggaactgtcgcgcctgatgcgtcaccgcggacccgactggtccggtgtgtttgcc
agcgataaagccattctgtcgcatgagcgtctgtccattgtcgacgtgaacaacggcgca
caacctttgtacaacgcagcacacacccacgttctggctgtgaacggcgaaatttacaac
catcaggctttgcgcgcagaactgggcgacaagtatgaattccagaccgcatctgactgt
gaagtcattctggcgctgtatcaggaaaaaggccctgccttcctcgatgaactgcaaggt
atgttcgcctttattctgtatgacacagaaaaagacgcgtacctgattggccgcgaccat
ctgggcattatcccgctgtacatgggctacgacgaacacggcaacatgtacgtcgcttca
gaaatgaaagcgctggtgccggtttgtcgcaccatcaaagaattcccggcaggcagctat
ctgtggagccaggacggtgaaattcgcgaatactaccagcgtgactggtttgacttcgaa
aacgtcaaagacaatgtgaccgacgctgcggcgctgaaagatgcactggaagaagcggta
aaaagtcacctgatgtctgacgtgccttacggcgtgctgctgtccggtggtctggattcc
tccgtgatttccgccatcaccaagaaatttgccggccgccgtatcgaagataaagatcag
agcgaagcctggtggccgcaactgcactcctttgccgtcggtctgcaaggttcaccggac
ctgcgcgctgctcaggaagtcgccaaccatttaggcaccgtgcaccacgaaattcacttc
accgtgcaggaaggtctggatgctatccgcgatgttatctatcacattgaaacgtatgac
gtcacgactatccgcgcatcaacaccgatgtatctgatgtcgcgtaaaatcaaagcgatg
ggcatcaaaatggtgttgtctggcgaaggcgcagacgaagtgttgggcggctacctgtat
ttccataaagcgccaaacgccaaagaatttcatgaagaaaccgtgcgtaaattgctggcc
ctgcatatgtatgactgtgcgcgtgccaacaaagccatgtcagcctggggtgtggaagcc
cgcgtcccgttcctggacaaaaaattcctcgacgtcgcgatgcgtatcaacccgaaagac
aagatgtgcggcaacggcaagatggagaaacatatcctgcgtgaatgtttcgagtcttat
ttgccacacagcgtggcctggcgccagaaagaacagttctctgatggcgtaggttacagc
tggatcgataccttaaaagaagtggcctctcagcagatcaccgatcaacagcttgaaact
gcacatttccgtttcccgtacaacacgccgacctcgaaagaaggctacctgtaccgtacg
atttttgaagagttattcccggtgccaagcgcggctgaatgtgtgcctggcgggccgtca
gtggcctgttcttcagcgaaagctattgaatgggacgaagcgttcaaaaacatggacgat
ccttctggccgtgccgttggcgtgcatcagtccgcttataaataa

DBGET integrated database retrieval system