KEGG   Rahnella aquatilis HX2: Q7S_16605Help
Entry
Q7S_16605         CDS       T01850                                 

Definition
multifunctional acyl-CoA thioesterase I/protease I/lysophospholipase L1
Orthology
K10804  
acyl-CoA thioesterase I [EC:3.1.2.- 3.1.1.5]
Organism
raa  Rahnella aquatilis HX2
Pathway
Biosynthesis of unsaturated fatty acids
Brite
KEGG Orthology (KO) [BR:raa00001]
 Metabolism
  Lipid metabolism
   01040 Biosynthesis of unsaturated fatty acids
    Q7S_16605
Enzymes [BR:raa01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.5  lysophospholipase
     Q7S_16605
   3.1.2  Thioester hydrolases
    3.1.2.-  
     Q7S_16605
Lipid biosynthesis proteins [BR:raa01004]
 Fatty acid synthase
  Component type
   Q7S_16605
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3629164..3629793
Genome map
AA seq 209 aa AA seqDB search
MNFKNIFRWHLPFLMLLGLLSFRAVAADNLLIIGDSLSAVYRLPVAESWPTLLNNTWQKE
GGKPTIINASISGDTAEQGLARLPSLLQQHHPRWVLIELGANDGLRGFPPQTLSRTLQQV
IEQVKQSNAQPLLMQIRLPPNYGRRYGDAFYAIYPALAKQENIPLVPFFMEQVAVKPEWM
QDDGLHPALAAQSFIAGWMSEKLTPLLTH
NT seq 630 nt NT seq  +upstreamnt  +downstreamnt
atgaacttcaagaacattttccgctggcatctccccttccttatgttgttaggattattg
agttttcgcgccgttgctgctgataacttgctgattattggcgacagtttgagtgcagtc
tatcgccttccggtagccgaatcctggccgacattactgaataacacatggcaaaaagaa
ggtggcaagcccaccataatcaacgccagtatcagcggcgataccgctgaacaagggctg
gcacgcctgccatccttgctgcaacaacatcacccccgctgggtgctgattgaactgggt
gccaacgacggattgcggggtttcccgccacaaaccctttcccggacgctgcaacaggtg
attgaacaggtaaaacagagcaatgcccaaccgttgctgatgcaaatccgtctgccaccc
aattatggccgccgctacggcgacgcgttctacgccatttatccggcgctggcaaagcag
gaaaacatcccgctggtgccgttctttatggagcaggtcgccgtgaaacctgaatggatg
caggacgacggtttacatcctgcgctggcagcacaatcctttattgccggatggatgtca
gaaaaactcacgccgctgctgacgcattag

DBGET integrated database retrieval system