KEGG   Rahnella aquatilis HX2: Q7S_18450Help
Entry
Q7S_18450         CDS       T01850                                 

Definition
2-amino-4-hydroxy-6-hydroxymethyldihydropteridine pyrophosphokinase
Orthology
K00950  
2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase [EC:2.7.6.3]
Organism
raa  Rahnella aquatilis HX2
Pathway
Folate biosynthesis
Metabolic pathways
Module
Tetrahydrofolate biosynthesis, GTP => THF
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:raa00790]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
4037674..4038153
Genome map
AA seq 159 aa AA seqDB search
MIRVYLALGSNLARPLDQVNCALEALAHLPRTRFVAASPFYRSKPLGPQDQPDYLNAVVA
LDTLLPPEELLDCTQGIEQNQGRVRKAERWGPRTLDLDMLIYGDQVINTERLTVPHYDMK
NREFMLYPLADLAPELVFPDGETLQTLLARVPLNGLTKW
NT seq 480 nt NT seq  +upstreamnt  +downstreamnt
atgatccgcgtttacctggctctgggcagtaatcttgcccgtccgcttgaccaggtaaac
tgtgcgctggaggcgctggcacatttgccgcgcacccgctttgtggccgcatccccgttt
taccgcagtaaaccgctggggccacaggatcaacctgattatctgaatgctgtggtggcg
ctcgatacgctgctgccgccggaagagttgctcgattgcacacaagggatcgagcaaaat
cagggacgcgtccgcaaagccgaacgctgggggccgcggacgttagatcttgatatgctg
atttatggcgatcaggtgatcaacaccgagcgtttaacggtgccgcattacgacatgaaa
aaccgcgaattcatgctgtatccgctggccgatctggcaccagaactggtgttccctgac
ggcgaaaccttgcaaactctgctcgcccgcgtgccgcttaacggtctgaccaaatggtaa

DBGET integrated database retrieval system