KEGG   Rahnella aquatilis HX2: Q7S_19490Help
Entry
Q7S_19490         CDS       T01850                                 

Definition
lysozyme
Orthology
K13381  
bifunctional chitinase/lysozyme [EC:3.2.1.14 3.2.1.17]
Organism
raa  Rahnella aquatilis HX2
Pathway
Amino sugar and nucleotide sugar metabolism
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:raa00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    Q7S_19490
Enzymes [BR:raa01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.14  chitinase
     Q7S_19490
    3.2.1.17  lysozyme
     Q7S_19490
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(4265385..4267940)
Genome map
AA seq 851 aa AA seqDB search
MRMNKITQMLCVAGLTMASASAFALEAWNGQEGGDTFEVIFDGSVYSNAWWVGATNCPGT
AEQDQGANPWRKVRDASATEMSQYGNPTVCEIAGDGTQNNYVDYDSSRDYLAGDIVLANG
MTYKTSKPTPAHSFAPAENNPWVVYAPTPVWSSSATYNQGDKVQKDGVMYEALFYTINND
PSLTANQNPDGNNGHPWKPLGPVQTYSQDQIDNAPTLNIDTLYPANSLVKYNGKNYQSSV
IVQKVKPDDVSPWAVYMDWSGTKERVGTPKNPWPAQFYAPYVDFTLNMQPDLVGLAKNQN
VNHFTMAFMVAKDANTCVPTWGTAYSVTNYAQYSKIKALREAGGDIMVSIGGANNAPLAA
ACNNVNDLQQHYYDIVENLNLQVLDFDIEGNWLADKESIQRRNAAVKLVQDRWAAEGRHI
GVWYTLPVLPTGLTHEGMEVLQDAKDQGVVLTGINVMAMDYGNVQCQSANTEGQNIHGKC
ATSAIDNLFTQVKGLYPEKSAAQVYAMLGTTPMIGYNDVQGEVFYLSDARLVYQQAKDYG
LGMIGAWSVARDQPGVSGQVSAEHSGMTPEQAPMYAYSEIFAPITSGSPAPVETNTPPVA
NAGIAQQVNGTAVITLDGSASTDKEGDTLTYQWKQVSGPAVTLQNSDAAKATFSVAQPVT
NAVYTFSLTVSDGEGSTTAQTSVNVIDASKPVAPSVTLESTYTVTSGESLTLTAKVTDPD
TQAADLHYQWTNPAGLPVAPAQGAASNTEVINAPQVTVDTRFTVDVTVTDNTRLTDTATT
TILVKAKTAAGDYEYVYPQSSEKYVAGTRVLGSDGGIYQCKPFPYSGWCSQAAWAYAPAT
GTNWQDAWDKQ
NT seq 2556 nt NT seq  +upstreamnt  +downstreamnt
atgagaatgaataaaatcacacagatgctctgtgttgccggtttgacgatggcttcagcc
agcgcttttgcccttgaagcctggaacggacaggaagggggtgacacatttgaagtcatc
tttgacggcagtgtttactcaaatgcctggtgggtcggtgcgacaaactgcccgggcaca
gcggaacaagatcaaggtgccaacccttggcgtaaggtgcgcgacgcatctgcgactgaa
atgagccaatatggcaacccgaccgtttgtgagattgccggcgacggcacgcagaataat
tatgtcgattatgacagcagtcgtgattatttagccggtgatattgttctggcaaatggc
atgacatacaaaacgtctaaaccaacgccggctcacagtttcgcaccagcagaaaataac
ccgtgggtagtgtatgcaccgacgccggtctggagcagcagtgcaacctataatcagggc
gataaagttcagaaagacggagttatgtatgaagctctgttttacaccattaataatgat
ccgtcgctgacggctaatcagaacccggacggaaataatggccatccgtggaaacctcta
ggtccggttcaaacctactctcaggatcaaattgataacgcgccaacgctgaatatcgat
accttatatcctgctaattcattagtgaaatataacggcaaaaattatcagtcttctgta
atagttcagaaagttaaacctgacgatgtttcaccgtgggctgtgtatatggactggagc
ggcacgaaagagcgcgtgggtacgccgaaaaatccgtggcctgctcagttctatgcgcct
tatgtcgatttcaccttaaatatgcagcctgaccttgtcggtctggcgaaaaaccagaac
gttaaccacttcaccatggcctttatggtcgctaaagatgctaacacctgtgtaccgacg
tggggcaccgcttacagtgttaccaactacgcgcaatacagcaaaatcaaagcattacgt
gaagcaggcggcgatatcatggtgtcgatcggcggcgcgaacaatgcgcctctggccgca
gcctgtaataacgtgaatgatctgcaacagcattattatgacattgtcgaaaacctgaac
ctgcaggtgcttgacttcgatatcgaaggaaactggctggctgataaagaatctattcag
cgccgcaatgccgccgtcaaattagtacaggatcgctgggctgccgaaggccgtcacatc
ggtgtctggtataccctgcctgttctgccaaccggtttaacccatgaagggatggaagtg
ttgcaggatgccaaagatcagggcgtcgtgctgaccgggattaacgtgatggcgatggat
tacggcaacgtacaatgccagtcagccaacactgaaggtcagaatattcacggtaaatgt
gccacttctgccatcgataatctgttcactcaggtgaaaggtttataccctgagaagagc
gccgcacaggtttacgccatgctggggacaacgccgatgattggctataacgatgtgcag
ggagaagtgttctatctttccgatgcgcgtctggtttatcagcaggcaaaagattatggc
ctgggtatgatcggtgcgtggtctgtggcgcgtgatcagccgggtgtttcagggcaagtt
tctgcggaacacagtggtatgacgccggaacaggctccgatgtacgcttacagcgaaatc
tttgcgccaatcaccagcggttcaccggcaccggtagaaaccaatacgccgccggtcgct
aatgccggtattgctcagcaggttaatggaaccgctgttatcacgcttgacggttcagcc
agcaccgataaagaaggcgacaccctgacgtatcagtggaagcaagtttccgggccagca
gtgacgctgcaaaacagcgacgcggcaaaagcgacattcagcgtggcgcaaccggtgacc
aatgcggtgtataccttctcgctgaccgtgagtgacggcgaaggcagcaccacagcgcaa
accagcgtgaatgtgattgatgcgtctaagcctgttgcaccgtccgttacccttgaatcc
acgtataccgtgacttcaggtgaatcgctgacgctgacagcaaaagtgacagatccggat
acgcaggctgctgatttacattatcagtggactaatccggctggattgccagtcgcaccg
gctcagggggcagcatccaacactgaagtgatcaatgcaccacaagtgacagttgatacg
cgctttactgtcgacgtgaccgtcactgataacacccgtttaaccgataccgcaacgacc
acgattctggtgaaagccaaaacagcggcaggggattatgagtatgtttatccgcaaagt
agtgagaaatacgtcgcgggaacccgggtattaggcagtgacggtggcatctatcaatgt
aagcctttcccatactccggttggtgtagtcaggcggcctgggcgtatgctcctgcgacc
ggcactaactggcaggatgcgtgggataaacagtaa

DBGET integrated database retrieval system