KEGG   Rahnella aquatilis HX2: Q7S_19515Help
Entry
Q7S_19515         CDS       T01850                                 

Definition
DNA polymerase III subunit psi
Orthology
K02344  
DNA polymerase III subunit psi [EC:2.7.7.7]
Organism
raa  Rahnella aquatilis HX2
Pathway
Purine metabolism
Pyrimidine metabolism
Metabolic pathways
DNA replication
Mismatch repair
Homologous recombination
Module
DNA polymerase III complex, bacteria
Brite
KEGG Orthology (KO) [BR:raa00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    Q7S_19515
   00240 Pyrimidine metabolism
    Q7S_19515
 Genetic Information Processing
  Replication and repair
   03030 DNA replication
    Q7S_19515
   03430 Mismatch repair
    Q7S_19515
   03440 Homologous recombination
    Q7S_19515
Enzymes [BR:raa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.7  DNA-directed DNA polymerase
     Q7S_19515
DNA replication proteins [BR:raa03032]
 Prokaryotic Type
  DNA Replication Elongation factors
   Elongation factors (bacterial)
    DNA polymerase III holoenzyme
     Q7S_19515
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(4272336..4272749)
Genome map
AA seq 137 aa AA seqDB search
MASRRDTLLQQLGITQWTLRRPAVLQGEVAVSLPAGTKLLIVAAVPPAEDDPLVSDVLRS
LTLKESEVYRLTPEQVTMLPEDTRCNIWRLGVSEPLTLTGPQLSTPALAELYQDAGAKRA
LWQQICENEQHFYPDAR
NT seq 414 nt NT seq  +upstreamnt  +downstreamnt
atggcatccagacgagatacattattacaacagctgggcattacccagtggacgctgcgc
cggcctgctgtattacaaggcgaagtggcagtcagtctgcccgcgggaactaaattgctg
atcgtcgccgccgttccgccagcagaagatgatccgctggtcagcgatgttttgcgcagc
ctgacgctaaaagaatcagaagtttaccgcctgacgcctgaacaggtcactatgttacct
gaagatacccgctgcaatatctggcgactgggggtaagcgaaccgctgactctcactggc
ccgcagctctccactccggccctggccgaactctatcaagacgccggcgccaaacgcgcg
ctctggcagcagatctgtgaaaatgaacaacatttctatcctgacgcccgctga

  All links  
No link information was found.   
DBGET integrated database retrieval system