KEGG   Rahnella aquatilis HX2: Q7S_19775Help
Entry
Q7S_19775         CDS       T01850                                 

Definition
alpha amylase
Orthology
K00690  
sucrose phosphorylase [EC:2.4.1.7]
Organism
raa  Rahnella aquatilis HX2
Pathway
Starch and sucrose metabolism
Brite
KEGG Orthology (KO) [BR:raa00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    Q7S_19775
Enzymes [BR:raa01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.7  sucrose phosphorylase
     Q7S_19775
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
4333901..4335673
Genome map
AA seq 590 aa AA seqDB search
MSSVNLEYVLRLESLLSRIYPREHIADLLKKILHLADKWNYGKHRTTRWVDGTNIYLITY
GDNIRHGEQPPLATLNHFANTYLRDIISDIHILPMYPYYRRIDEHLGGWSDIHHLSANFN
LMFDCVINHISRSSEWMKGYLHDDPYYKDYFIAANPELDYSRVVRPRASPLLSPFIKTDG
TELYLWTTFSEDQIDINFKNPQVLLESIDVLLQYAASGGQSIRLDAIGYIWKEAGTRCIH
MPQAHNIIKVWRTILDEVIPGTRIITETNVPHHENISYFGEGDEAHMVYQFPLPPLTLHA
FLRQDTTTLTQWAQSLNAEARYPDTTYFNFLASHDGIGLRPTETFLTDDERKYMAQETLR
KEGRVSYKDNGDGTHSPYELNINYLSALTEPEDNTEMKARKFLAAQALLLSFIGVPAIYI
HSLLGSENDLDGMHQSGINRRINRKKLDLMDIEAELEKKDGLRARIFYGLQALIRHRREH
PAFSPQAGQRVFDLGKSLFAMERYDPKTEDRISCIFNISDHSQMLKLAVEGKDLISGEVF
NGQMRLQPWQVVWIKHKLKAPERLGRLRRWRMKLIKRTKRYTISIKRTMR
NT seq 1773 nt NT seq  +upstreamnt  +downstreamnt
atgagctcagtcaatcttgagtatgttctgcggctggaaagcctgttaagcaggatttac
ccccgggaacacatcgccgacctgctgaaaaaaatcctgcatctcgccgacaaatggaat
tacggcaaacaccgcaccacccgctgggtggatgggaccaatatttatctgattacttat
ggcgataatatccgtcacggcgagcaaccgccgctggcgacgctcaatcatttcgctaac
acttatctgcgcgacattatcagcgacatccatattctgccgatgtatccgtactaccgg
cggatcgatgaacatcttggcggctggtcagatattcatcacctttcggccaatttcaac
ctgatgtttgattgcgtgatcaaccatatttcccgctcaagcgaatggatgaaaggctat
ctgcatgacgatccgtattacaaagattactttattgccgctaatcccgagctggattac
agccgcgtcgtgcgcccgcgcgcttcgccgctgctctcgccatttatcaaaaccgacggc
accgaactgtatctgtggacgacgttcagtgaagatcagatcgatattaatttcaagaat
cctcaggtcttgctggaaagcattgatgtgctgttgcaatacgccgccagcggcggacag
tcgatccgccttgatgcgattggctatatctggaaagaagccgggacgcgctgcattcac
atgccacaggcgcataacatcattaaagtctggcgcactattctcgatgaagtgatcccc
ggcacgcggatcatcactgaaaccaacgtcccgcaccacgaaaatatcagttatttcggc
gaaggtgacgaggcacacatggtgtatcagttcccgctgccaccgctgaccttgcacgct
tttttgcgtcaggacaccaccacgctcacccaatgggcgcaaagcctgaatgcggaagcc
cgttaccctgacaccacctatttcaacttccttgccagccacgacggcatcggtttacgt
ccgaccgaaaccttcctgaccgatgacgaacgtaaatacatggcgcaggaaacgctgcgc
aaggaaggccgcgtgtcctacaaagacaacggcgacggcacccattcgccttacgaactg
aacattaattacctgagcgcgctgaccgaaccggaagataataccgagatgaaagcccgc
aagtttctggcggcacaggcgctgttattgtcgtttatcggcgtcccggcgatttatatt
cacagcctgctgggcagcgagaacgatctcgacggcatgcatcagtccgggatcaaccgc
cgcatcaaccgtaaaaagctggatctgatggatattgaagctgaactggaaaaaaaagac
ggcttacgcgcccgcattttttacggattacaggcactcatcaggcaccgccgcgagcac
ccggcattttcaccgcaggctggccagcgcgtgtttgatctgggcaaatcgctgtttgcg
atggaacgctatgatccgaaaaccgaagaccggatcagctgcatattcaatatcagcgat
cattcgcagatgctgaagctggcggtcgaagggaaggatctgattagcggagaagtattt
aacggccagatgcgtctccagccgtggcaggtggtgtggatcaaacacaaactcaaagcg
ccggaacgtctcggcaggctgcgtcgctggcggatgaagctgatcaagcgcacaaagcgc
tacacaataagcattaagcggacaatgcgctga

DBGET integrated database retrieval system