KEGG   Rahnella aquatilis HX2: Q7S_20910Help
Entry
Q7S_20910         CDS       T01850                                 

Definition
(GenBank) malate synthase
  KO
K01638  malate synthase [EC:2.3.3.9]
Organism
raa  Rahnella aquatilis HX2
Pathway
raa00620  Pyruvate metabolism
raa00630  Glyoxylate and dicarboxylate metabolism
raa01100  Metabolic pathways
raa01110  Biosynthesis of secondary metabolites
raa01120  Microbial metabolism in diverse environments
raa01200  Carbon metabolism
Module
raa_M00012  Glyoxylate cycle
Brite
KEGG Orthology (KO) [BR:raa00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    Q7S_20910
   00630 Glyoxylate and dicarboxylate metabolism
    Q7S_20910
Enzymes [BR:raa01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.3  Acyl groups converted into alkyl groups on transfer
    2.3.3.9  malate synthase
     Q7S_20910
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Malate_synthase HpcH_HpaI
Motif
Other DBs
NCBI-ProteinID: AFE60391
UniProt: H8NQR6
Position
complement(4575668..4577266)
Genome map
AA seq 532 aa AA seqDB search
MSEQITRSQLGFTRRFGENEAQILTEEAVDFLSELVVRFTPLRNRLLADRIAVQQKIDQG
VLPDFISETHSIKNSDWKVRGIPADLLDRRVEITGPVERKMVINALNANVKVFMADFEDS
LAPDWQKVIEGQINLRDAVNGSISYTNESGKIYQLKPDPAVLICRVRGLHLPEKHVNWQG
EAIPGSLFDFALYFFHNYRALLAKGSGPYFYLPKMQSYHEADWWSQVFSFAEDYAGLARG
TIKATVLIETLPAVFQMDEILYHLRDHIVGLNCGRWDYIFSYIKTLKNHSDRILPDRQSV
TMTQPFLNAYSRLLIKTCHRRGAFAMGGMAAFIPSKDVKRNEWVLNKVRTDKELEANNGH
DGTWIAHPGLADTVLEVFDKALGNRSNQLDVLREEDAEITAEQLLEPCSGERTEEGMRAN
IRVAVQYIEAWISGNGCVPIYGLMEDAATAEISRTSIWQWIHHGKTLNDGQPVTKPLFRR
MLNEEMLVIQQELGEQRFSAGRFTQAAALMEKITTQDELIDFLTLPGYQLLA
NT seq 1599 nt NT seq  +upstreamnt  +downstreamnt
atgtctgagcaaattacccgcagtcagcttggttttacgcgccgttttggtgaaaacgaa
gcgcaaattctgaccgaagaagccgtggattttttatccgaactggttgtccgttttacc
ccgctgcgaaatcgattactggccgatcgcattgccgtacagcagaagatagatcagggg
gtgttgcctgattttatttcggaaacgcattccataaaaaattcagattggaaggtacgg
ggcattccggctgatttactggatcgccgggtagaaatcactggtcctgtcgaacgcaag
atggtgatcaatgcgctgaacgccaatgtaaaagtctttatggcggattttgaggactct
ctggcaccggactggcagaaagttatagaagggcagattaacttacgcgatgcggtgaac
gggagtatcagctacaccaatgaatccgggaaaatttatcagctcaaacctgatcctgcc
gttctgatttgtcgtgtacgtggcctgcatttacctgaaaagcatgtgaactggcagggt
gaagctattcccggttcgttgttcgacttcgctttgtactttttccataactatcgcgca
ttactggcaaaaggcagtggcccctatttctatctgccaaaaatgcagtcttatcatgag
gctgactggtggagccaggtcttcagttttgccgaggattatgcgggattggcgcggggc
acgattaaagccacggtgctgattgaaaccctgcctgcggttttccagatggacgaaatc
ctttaccacttgcgcgatcacattgtcggactgaactgtggtcgctgggattacatcttc
agttatatcaaaacgttgaagaatcattctgaccgtatattacctgaccgtcagtccgta
acgatgactcagccttttctaaatgcttattcccggctgctgattaaaacctgtcaccgg
cgtggggcatttgcgatgggcggaatggcagcatttattcccagcaaagacgttaagcgt
aacgagtgggtgctgaataaagtccgcacagacaaagagctggaagcgaataacggacat
gatggtacctggattgcacaccctgggctggcagacaccgtgcttgaagtgttcgacaaa
gcgctgggtaaccgttcaaaccagctggatgtactacgtgaagaagatgccgaaattact
gcagagcaattactcgaaccttgttccggcgagcgtactgaagagggaatgcgcgccaat
attcgcgtcgcagtgcaatacattgaagcctggatttctggcaacggctgcgtcccgatt
tacgggttgatggaagatgctgccacggctgaaatctcccgcacatccatctggcaatgg
atccaccacggcaaaacgcttaatgacggacaacccgtcaccaagccgttattccgccgc
atgctgaacgaagaaatgctggttattcagcaggagttgggcgaacaacgtttcagtgcc
ggtcgtttcacgcaggcggctgccttgatggaaaaaatcaccacacaagatgagttaatc
gacttcctgaccctgccgggctatcagctgctggcctga

DBGET integrated database retrieval system