KEGG   Rahnella aquatilis HX2: Q7S_21080Help
Entry
Q7S_21080         CDS       T01850                                 

Gene name
fadB
Definition
multifunctional fatty acid oxidation complex subunit alpha (EC:5.1.2.3)
Orthology
K01825  
3-hydroxyacyl-CoA dehydrogenase / enoyl-CoA hydratase / 3-hydroxybutyryl-CoA epimerase / enoyl-CoA isomerase [EC:1.1.1.35 4.2.1.17 5.1.2.3 5.3.3.8]
Organism
raa  Rahnella aquatilis HX2
Pathway
Fatty acid degradation
Valine, leucine and isoleucine degradation
Geraniol degradation
Lysine degradation
Tryptophan metabolism
beta-Alanine metabolism
Propanoate metabolism
Butanoate metabolism
Limonene and pinene degradation
Caprolactam degradation
Biosynthesis of unsaturated fatty acids
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Fatty acid metabolism
Module
beta-Oxidation
Brite
KEGG Orthology (KO) [BR:raa00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Q7S_21080 (fadB)
   01212 Fatty acid metabolism
    Q7S_21080 (fadB)
  Carbohydrate metabolism
   00640 Propanoate metabolism
    Q7S_21080 (fadB)
   00650 Butanoate metabolism
    Q7S_21080 (fadB)
  Lipid metabolism
   00071 Fatty acid degradation
    Q7S_21080 (fadB)
   01040 Biosynthesis of unsaturated fatty acids
    Q7S_21080 (fadB)
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    Q7S_21080 (fadB)
   00310 Lysine degradation
    Q7S_21080 (fadB)
   00380 Tryptophan metabolism
    Q7S_21080 (fadB)
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    Q7S_21080 (fadB)
  Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    Q7S_21080 (fadB)
   00281 Geraniol degradation
    Q7S_21080 (fadB)
  Xenobiotics biodegradation and metabolism
   00930 Caprolactam degradation
    Q7S_21080 (fadB)
Enzymes [BR:raa01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.35  3-hydroxyacyl-CoA dehydrogenase
     Q7S_21080 (fadB)
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     Q7S_21080 (fadB)
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.2  Acting on hydroxy acids and derivatives
    5.1.2.3  3-hydroxybutyryl-CoA epimerase
     Q7S_21080 (fadB)
  5.3  Intramolecular oxidoreductases
   5.3.3  Transposing C=C bonds
    5.3.3.8  dodecenoyl-CoA isomerase
     Q7S_21080 (fadB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
4627167..4629359
Genome map
AA seq 730 aa AA seqDB search
MLYQGETLHLHWLDGGIAELVFDAPGSVNKLDTQTVASLGEAIAVLEKQSDLKGLLLSSA
KPAFIVGADITEFLSLFNAPAEKLHEWLDFANSIFNRLEDLPVPTLSAISGYALGGGCEC
VLATDFRISTADARIGLPETSLGIMPGFGGSVRLPRLIGTDSALEIIAAGKNISGKEALK
VGLVDAVVEADKLRDAGISMLRNAVDGKLEWHNRRDPKRLPLKLSQIEAAMSFSVAKSMV
MQNAGKHYPAPMSAVKTIEAAARLGRDEALQLETASFVPLAQSKEARALVSIFLNDQFVK
SKAKKLAQDSEKPKQAAVLGAGIMGGGIAYQSALKGVPVVMKDINDQSLTLGMNEAAKLL
NKQLERGKLDGLKMAKVLSTIHPTLDYSGIERASVVVEAVVENPKVKAAVLAEAESLLGT
DTVLASNTSTIPIDLLASSLKRPENFCGMHFFNPVHRMPLVEIVRGEKTSDKTISRIVSY
ALAMGKTPIVVNDCPGFFVNRVLFPYFSGFSLLLRDGADFRQIDKVMEKQFGWPMGPAYL
LDVVGIDTAHHAQAVMAAGFPERMARDYRDAVDVLFDNRRFGQKNQLGFYRYSEDSKGKP
RKEVDEQAISLLADNLKPAHTDFSPQDIIARMMIPMINEVVRCFEEGIIASPAEADMALV
YGIGFPPFHGGPFRYLDTLGTTEYLKMTEQYAHLGPMYQAPEGLRAKAQTNESYYPVAAP
LENFSTGNQA
NT seq 2193 nt NT seq  +upstreamnt  +downstreamnt
atgctctaccaaggcgaaacactacacctgcactggctcgacggcggtatcgcggagctg
gtgtttgatgccccaggctcggttaacaagctcgacacccaaactgtcgccagcctgggc
gaagccattgcagtacttgaaaaacagtctgacctgaaaggtctgctgctcagttcggcc
aaaccagcgtttatcgtgggcgcggatatcaccgaatttttatccctgttcaacgcgcca
gccgaaaaactgcatgaatggctggatttcgccaacagcatttttaaccggctggaagac
ctgccggtaccgacactttctgccatcagcggttatgcgctgggcggcggttgcgaatgc
gtgctggcgacagattttcgtatcagcactgccgatgcccggattggcctgccggaaacc
agtttagggattatgccgggcttcggcggttccgtacgtctgccacgtctgattgggacc
gatagtgcgctggaaattatcgccgccggtaaaaatatcagcggaaaagaggccctgaaa
gtcgggctggtcgatgcagtggttgaagccgataaactgcgcgacgctggcatcagcatg
ctgagaaacgccgttgacggcaaactggaatggcataaccgtcgtgatcctaaacgtctg
ccgttgaaactgagccagattgaagcggcgatgagcttcagcgtcgccaaaagtatggtc
atgcaaaatgccggtaaacactatccggcgcccatgagcgcggtgaaaaccatagaagcc
gcggcccgtctgggtcgtgatgaagcgttgcagctggaaaccgccagctttgtgccgctc
gcacaatcaaaagaagcccgcgcactggtcagtattttccttaacgatcagtttgtgaaa
agcaaagccaaaaaactggcgcaagacagcgaaaaaccaaaacaggccgccgtattgggc
gcgggcattatgggcggcgggatcgcctaccagtctgcgctgaaaggcgtgccggttgtg
atgaaagatatcaacgaccagtccctgacgctcggcatgaacgaggctgccaagttgctg
aacaagcaactggagcgcggtaaactcgacggtctgaaaatggctaaagtgctgtcgacc
attcatccgacgctggattacagcggcatcgaacgtgcctctgtggtcgttgaagccgtg
gtcgagaatcctaaagtgaaggccgcggtgctggcggaagcggaatctctgctcggcacc
gataccgttctggcctcgaatacctcgaccattcctatcgatctgttggcgtcttcgctc
aaacgcccggaaaacttctgtggtatgcacttcttcaacccggtgcatcgtatgccgctg
gtcgaaatcgtgcgtggtgagaaaacctcagacaaaacgatttcgcgcatcgtttcttac
gcactggcgatgggtaaaacgcctatcgtggtcaacgactgcccgggattcttcgtcaac
cgcgtactgttcccgtatttctccggtttcagtctgttactgcgtgatggcgctgatttc
cgccagatcgacaaagtgatggaaaaacagttcggctggccgatgggtccggcttatctg
ctggatgtggtcggcatcgacaccgcgcatcacgcccaggccgtgatggccgccggtttc
cctgagcgcatggcacgggattaccgtgacgctgttgatgtgctgtttgataaccgtcgt
tttgggcagaaaaatcaactcggtttctaccgttacagcgaagacagcaaaggcaagccg
cgcaaggaagttgacgaacaggcgatcagtctgctggccgacaacctgaaaccagcacac
actgacttctcaccgcaggacatcatcgcccgcatgatgattccgatgattaacgaagtg
gtgcgctgctttgaggaaggcattattgccagcccggccgaagccgacatggcgctggtt
tacggcatcggattcccccctttccacggcggcccgttccgttatctcgataccctcggt
accactgagtatctgaaaatgactgaacagtatgcacatctggggccgatgtatcaggca
ccggaagggctacgcgccaaagcgcaaaccaatgaaagttactatccggttgccgctccg
ctggaaaacttcagcaccggtaatcaggcataa

DBGET integrated database retrieval system