KEGG   Rahnella aquatilis HX2: Q7S_21510Help
Entry
Q7S_21510         CDS       T01850                                 

Definition
lysophospholipase L2 (EC:3.1.1.5)
Orthology
K01048  
lysophospholipase [EC:3.1.1.5]
Organism
raa  Rahnella aquatilis HX2
Pathway
Glycerophospholipid metabolism
Brite
KEGG Orthology (KO) [BR:raa00001]
 Metabolism
  Lipid metabolism
   00564 Glycerophospholipid metabolism
    Q7S_21510
Enzymes [BR:raa01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.5  lysophospholipase
     Q7S_21510
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(4719048..4720040)
Genome map
AA seq 330 aa AA seqDB search
MPVNFGKWLTREKEFSAFATGPLLDFWRTREEGEFSGVDDVPIRYVRFCSPAHDKVIVVS
PGRIESYVKYPEVAYDLFHCGYDVMIVDHRGQGRSGRMLDDPHCGHVKHFDDYVEDFESF
YQLEIAPRQYAKKFALAHSMGGAILALFLAKNPDKFDAAALLAPMTGIYLPMPGWISRRI
LNWAENRPLRRDGYALGTGHWRPLPFVVNRLTHSRERYRRNLRFYADYPELQVGGPTYHW
VREGIEAGMHILKEAEKITTPVLLLQASEDRVVDNRSHLAFCQAMAVAGHPCEGEKPLVI
EGARHEILFERDDLRAQALDAIMRFFARQH
NT seq 993 nt NT seq  +upstreamnt  +downstreamnt
atgcctgtgaattttgggaagtggttaacacgagagaaggagttttccgccttcgcgacc
ggacctttgctggatttctggcgtacgcgcgaagaaggcgagtttagcggcgttgacgat
gtcccgatccgctatgtccggttctgttcccccgcgcatgataaagtcatcgtggtgtca
ccgggtcgtatagaaagctacgtaaaatatcctgaagtagcctacgatttattccattgc
ggctacgatgtcatgattgtcgatcaccgtggtcaggggcgttccgggcgtatgctcgac
gatccgcattgtggccacgttaagcattttgacgattatgttgaggatttcgaaagcttt
tatcagctggagattgccccacgtcagtacgcgaaaaagttcgcgctggcacactccatg
ggcggtgcgatcctggcgctgtttctggcgaaaaatccggacaagtttgatgcagcggcg
ttactcgcgccgatgaccggcatttatttgccgatgccgggctggatttcccgccggatc
ctcaactgggcggagaatcgtccgctacgccgtgacggctatgcgctgggcaccggtcac
tggcggccattaccgtttgtggtcaaccgcctgacacacagccgtgagcgttatcgccgt
aatctgcgtttttatgccgattaccctgagctgcaggtcggtgggccaacctatcattgg
gtacgtgaagggattgaggcggggatgcatatcctgaaagaagccgaaaaaatcaccacc
cctgttctgttattgcaggcgagcgaagaccgtgtggtggataaccggtcccatcttgct
ttttgtcaggccatggccgttgcgggacacccttgtgaaggggaaaaaccgctggtcatt
gaaggcgcgcgccatgagatcctgtttgaacgggacgacctgagggcacaggcgctggac
gctatcatgcgcttttttgcgcgacagcattaa

DBGET integrated database retrieval system