KEGG   Rahnella aquatilis HX2: Q7S_21530Help
Entry
Q7S_21530         CDS       T01850                                 

Definition
phospholipase A (EC:3.1.1.32)
Orthology
K01058  
phospholipase A1 [EC:3.1.1.32 3.1.1.4]
Organism
raa  Rahnella aquatilis HX2
Pathway
Glycerophospholipid metabolism
Ether lipid metabolism
Arachidonic acid metabolism
alpha-Linolenic acid metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:raa00001]
 Metabolism
  Lipid metabolism
   00564 Glycerophospholipid metabolism
    Q7S_21530
   00565 Ether lipid metabolism
    Q7S_21530
   00590 Arachidonic acid metabolism
    Q7S_21530
   00591 Linoleic acid metabolism
    Q7S_21530
   00592 alpha-Linolenic acid metabolism
    Q7S_21530
Enzymes [BR:raa01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.4  phospholipase A2
     Q7S_21530
    3.1.1.32  phospholipase A1
     Q7S_21530
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(4723464..4724342)
Genome map
AA seq 292 aa AA seqDB search
MRKNWAVGAAMLAMPMLGHAAEATVQEVHDKPAVRGSIIANMLQEHDNPFTLYPYEQNYL
IYTDTSNINKKAIQSYDWADKARHDEVEFQLSLAFPLWRGIAGDNSVLGASYTQKSFWQL
SNSGESSPFRETNYEPQLFLAWATDYDFLGWTLREAEYGVSHQSNGRSDPTSRSWNRVYA
RFMAQNGNWQVDLKPWYRIPESDENDDNPDINKYMGYYRLKVGYAWGDSVFSVESRYNWN
TGYGGATTGWSYPISKQVRFYTQVFSGYGESLIDYNHKQTRIGVGIMLNDIM
NT seq 879 nt NT seq  +upstreamnt  +downstreamnt
atgcgtaaaaattgggctgtcggggccgccatgctggcgatgccaatgctgggacacgcc
gcagaggccactgtgcaggaagtgcatgataaacctgcggtacgcggaagtattattgcg
aatatgttgcaggagcacgacaacccgttcacattatatccttacgaacaaaactacctg
atttacactgataccagcaatatcaacaagaaagccattcagtcttacgactgggcagat
aaagcacgtcatgatgaagtcgagttccagctcagcctggcgttcccgttgtggcgtgga
attgcgggtgataattcggtgctcggcgcgtcttacacgcaaaaatcattctggcagctt
tccaacagcggcgagtcttcaccttttcgtgagaccaactacgagccacagcttttcctc
gcctgggcaacggattacgatttcctcggctggacattgcgcgaagcagaatatggtgtc
agccatcagtctaacggccgctcagatccgacgtcccgcagctggaaccgcgtgtatgcc
cgtttcatggcgcaaaacggtaactggcaggtggatttaaaaccgtggtaccgcatccct
gaaagcgatgaaaacgacgataacccggacatcaacaaatacatgggttattaccgcctg
aaagtcggttatgcgtggggtgacagcgtgttcagcgtggaaagccgttacaactggaat
accggttacggcggtgcgacgactggctggagctacccgatttccaaacaggttcgcttc
tatactcaggtatttagcggctacggcgagtcattgatcgactacaaccataagcagacc
cgtatcggtgtgggtattatgcttaacgacatcatgtaa

DBGET integrated database retrieval system