KEGG   Rahnella aquatilis HX2: Q7S_21600Help
Entry
Q7S_21600         CDS       T01850                                 

Gene name
hemD
Definition
(GenBank) uroporphyrinogen-III synthase
  KO
K01719  uroporphyrinogen-III synthase [EC:4.2.1.75]
Organism
raa  Rahnella aquatilis HX2
Pathway
raa00860  Porphyrin and chlorophyll metabolism
raa01100  Metabolic pathways
raa01110  Biosynthesis of secondary metabolites
raa01120  Microbial metabolism in diverse environments
Module
raa_M00121  Heme biosynthesis, glutamate => heme
raa_M00846  Siroheme biosynthesis, glutamate => siroheme
Brite
KEGG Orthology (KO) [BR:raa00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    Q7S_21600 (hemD)
Enzymes [BR:raa01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.75  uroporphyrinogen-III synthase
     Q7S_21600 (hemD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HEM4
Motif
Other DBs
NCBI-ProteinID: AFE60525
UniProt: H8NUH9
Position
4738761..4739510
Genome map
AA seq 249 aa AA seqDB search
MTILVTRPSPAGEALVSRLRALGRVAFHSPLIDFAPGNQLASLPNLLSSLNQQDLVFVLS
QHAVSYADRALRQSTTNWPDTVNYFAIGRTTGLIFHRVSSLPVLYPQDGETSETLLNLPA
LQRIQGKKALILRGNGGRELLAETLTERGVDVTYCECYQRSPVYYDASEQSALWQRAGVD
TLVVTSGEMLQQLYQLVPDYYRNSWLLRCNLVVVSERLAALARQLGWSAIRVAENADNDA
LIRALQLPD
NT seq 750 nt NT seq  +upstreamnt  +downstreamnt
atgaccattctggtcacccgcccctctccggcaggagaagcactggttagccggctgcgc
gctctggggcgggttgccttccattccccgctgattgattttgcaccggggaaccagctc
gcatcgcttccgaacctgctatcctcattaaatcagcaagatctggtgttcgtgctctcg
caacatgccgtcagttacgctgaccgggctttgcgccagtccaccacaaactggccggac
accgtgaattattttgccattggtcgcaccactggcctgattttccaccgggtcagcagc
ctgccggttctctatcctcaggatggcgaaaccagcgagacgctattgaatcttccggca
ttgcaacgcatacagggtaaaaaagcgctgatattgcgcggtaatggcggacgggagctg
ttagccgaaacgctgacagaacgcggtgtcgatgtcacttactgcgaatgttatcagcgc
agcccggtttactacgatgccagtgaacagagtgcactctggcaacgggccggagttgat
acgctggtcgtgaccagcggagaaatgctgcaacagttgtaccagttagttcctgattac
tatcgaaattcatggttactgcgctgtaatctggtggtggtcagtgaacgtttggcagcc
cttgcacgccagcttggctggagcgcaattcgggttgctgagaatgcagacaatgatgcg
ctgatccgcgcattacaactacctgactaa

DBGET integrated database retrieval system