KEGG   Rahnella aquatilis HX2: Q7S_21930Help
Entry
Q7S_21930         CDS       T01850                                 

Definition
glycerol kinase
Orthology
K00864  
glycerol kinase [EC:2.7.1.30]
Organism
raa  Rahnella aquatilis HX2
Pathway
Glycerolipid metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:raa00001]
 Metabolism
  Lipid metabolism
   00561 Glycerolipid metabolism
    Q7S_21930
Enzymes [BR:raa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.30  glycerol kinase
     Q7S_21930
Exosome [BR:raa04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   Q7S_21930
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
4824751..4826274
Genome map
AA seq 507 aa AA seqDB search
MSADTTHEKKYIVALDQGTTSSRAVVLDHDANIVSVSQREFTQIYPKSGWVEHDPMEIWS
SQSSVLVEVLAKADINSDQIAGIGITNQRETTIVWEKETGKPIYNAIVWQCRRTADICEK
LKKDGLEEYIRHNTGLVIDPYFSGTKLKWILDNVEGSRERAKRGELLFGTVDTWLVWKMT
QGRVHVTDYTNASRTMLFNIHDLQWDERMLEVLDIPREMLPEVRSSSEIYGQTNIGGKGG
TRIPIAGIAGDQQAALYGQLCVQPGMAKNTYGTGCFLLMNTGTEAVASKNGLLTTIACGP
RGEVNYALEGAVFVGGASIQWLRDELKLISDATDSEYFAMKVKDTNGVYVVPAFTGLGAP
YWDPYARGAIFGLSRGANSNHIIRATLESIAYQTRDVLDAMQADSGARLQALRVDGGAVA
NNFLMQFQSDILGTRVERPEVLEVTALGSAFLAGLAVGFWNDLEEVRSKATIEREFRPSI
ETTERNVRYKGWQKAVARVRSWEDHDE
NT seq 1524 nt NT seq  +upstreamnt  +downstreamnt
atgtcagcagatacgactcacgaaaaaaaatacattgttgcactcgaccagggtacaacc
agttcacgcgcggtagtgctggatcacgatgccaatatcgtcagcgtgtcacaacgcgaa
ttcacccagatctaccctaagtcaggctgggttgagcacgacccgatggaaatctggtca
tcgcaaagctcggtgctggtggaagtgctggcgaaagccgacattaactccgatcagatt
gccggtatcggtatcaccaaccagcgcgaaaccaccatcgtgtgggaaaaagaaactggc
aagccaatctataacgcgattgtctggcaatgtcgccgaactgctgacatctgcgaaaaa
ctgaaaaaagacggtctggaagaatacattcgccataacaccggcctggttatcgaccct
tacttctccggcaccaaactgaagtggatcctcgacaacgttgaaggctctcgcgaacgc
gctaaacgcggcgaactgctgttcggcaccgtcgacacctggttggtctggaaaatgacg
cagggacgtgttcacgtgacggattacaccaacgcttcgcgtaccatgctgttcaacatc
catgatctgcaatgggatgagcgcatgctggaagtgctggatattccacgtgaaatgctg
ccggaagttcgctcttcttctgagatttacggccagaccaacattggtggtaaaggcggt
acgcgtattcctatcgctggcatcgcaggtgaccagcaggcggcgctctatggtcagctg
tgtgtacaaccgggtatggcgaaaaacacctacggcactggctgcttcctgctgatgaat
accggtactgaagcggtcgcctctaaaaatggcctgctgactaccatcgcctgcggcccg
cgcggcgaagtcaactacgcgctggaaggggctgtgtttgtcggcggtgcgtccattcag
tggctgcgtgatgaactgaagctgatcagcgacgcaactgactccgaatatttcgccatg
aaagtgaaagacacgaacggcgtttacgtagtgcctgcctttaccggcctcggcgcccct
tactgggatccgtatgcccgcggcgcaatcttcggtctgagccgtggtgcgaacagcaac
cacatcatccgcgcgacgctggaatctatcgcttaccagacccgcgacgtactggatgcc
atgcaggcagactcgggcgctcgtctgcaggcactgcgtgtggacggcggtgcggtggcc
aacaacttcctgatgcaattccagtcagacattcttggcacccgcgttgagcgccctgaa
gtgctggaagtcaccgcgctgggttctgctttcctggcaggtctggccgtcggcttctgg
aacgacctggaagaagtgcgcagcaaagcgaccatcgaacgtgaattccgcccaagcatt
gaaacgacggaacgtaatgtccgctataaaggctggcaaaaagcggtggcacgcgttcgt
tcgtgggaagatcacgacgagtaa

DBGET integrated database retrieval system