KEGG   Rahnella aquatilis HX2: Q7S_21960Help
Entry
Q7S_21960         CDS       T01850                                 

Gene name
tpiA
Definition
(RefSeq) triosephosphate isomerase (EC:5.3.1.1)
  KO
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
raa  Rahnella aquatilis HX2
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Inositol phosphate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:raa00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Q7S_21960 (tpiA)
   01230 Biosynthesis of amino acids
    Q7S_21960 (tpiA)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Q7S_21960 (tpiA)
   00051 Fructose and mannose metabolism
    Q7S_21960 (tpiA)
   00562 Inositol phosphate metabolism
    Q7S_21960 (tpiA)
Enzymes [BR:raa01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     Q7S_21960 (tpiA)
Exosome [BR:raa04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   Q7S_21960 (tpiA)
  Exosomal proteins of bladder cancer cells
   Q7S_21960 (tpiA)
  Exosomal proteins of melanoma cells
   Q7S_21960 (tpiA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
4831082..4831849
Genome map
AA seq 255 aa AA seqDB search
MRHPLVMGNWKLNGSTHMVNELIAALRTELSTVVGCGVAIAPPEVYLSQAKHALAGSRIA
LGAQNVDANLSGAFTGEISADMLKDIGAQYIIIGHSERRTYHKESDELIAKKFGVLKEAG
LTPVLCIGETEAENEAGKTEAVCAKQLDAVLSTLGAKAFEGAVIAYEPVWAIGTGKSATP
AQAQAVHKFIRDHIAKQDAAVAEQVIIQYGGSVNAANAAELFTQPDIDGALVGGASLKAD
AFAVIVKAAAEAKQA
NT seq 768 nt NT seq  +upstreamnt  +downstreamnt
atgcgacatccattagtgatgggtaactggaagcttaacggcagcacccacatggttaac
gaactgattgctgctctgcgtactgaactgagcacagttgtaggttgtggcgttgcaatt
gctccaccagaagtttacctgtcacaggctaaacacgctctggctggcagccgtattgcg
ctgggtgctcagaacgttgatgctaacctgtctggcgcattcaccggtgaaatctctgcc
gacatgctgaaagacatcggtgcgcaatacatcatcatcggtcactcagaacgccgcact
taccacaaagaaagcgacgagttgatcgcgaaaaaattcggcgtgttgaaagaagcgggc
ctgactcctgttctgtgcatcggtgaaaccgaagcagaaaacgaagcaggcaaaactgaa
gccgtttgcgctaaacaactggacgcggttctgagcactctgggtgcgaaagcattcgaa
ggcgcagtcatcgcttacgaacctgtttgggcgatcggtaccggcaaatctgccaccccg
gctcaggctcaggctgttcacaaattcatccgtgaccacattgcgaaacaagatgctgcg
gttgctgaacaagttatcatccagtacggcggttctgttaacgctgcaaatgctgctgaa
ctgttcacccagccagacatcgatggcgcactggttggcggcgcatcactgaaagcagac
gctttcgctgtgatcgtgaaagccgctgctgaagctaaacaagcgtaa

DBGET integrated database retrieval system