KEGG   Rahnella aquatilis HX2: Q7S_21970Help
Entry
Q7S_21970         CDS       T01850                                 

Definition
6-phosphofructokinase (EC:2.7.1.11)
Orthology
K00850  
6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
raa  Rahnella aquatilis HX2
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:raa00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Q7S_21970
   01230 Biosynthesis of amino acids
    Q7S_21970
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Q7S_21970
   00030 Pentose phosphate pathway
    Q7S_21970
   00051 Fructose and mannose metabolism
    Q7S_21970
   00052 Galactose metabolism
    Q7S_21970
  Energy metabolism
   00680 Methane metabolism
    Q7S_21970
Enzymes [BR:raa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     Q7S_21970
Protein phosphatases and associated proteins [BR:raa01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     Q7S_21970
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(4833091..4834077)
Genome map
AA seq 328 aa AA seqDB search
MIKKIGVLTSGGDAPGMNAAIRGVVRAALSADLEVYGIEDGYLGMYENRMRKLDRYSVSD
MINRGGTFLGSARFPEFRDPEMRKVALQNMKDRGIDGLVVIGGDGSYAGADLLTKEGGIR
CIGLPGTIDNDVAGTDYTIGFFTALGTVVEAIDRLRDTSSSHQRISIVEVMGRYCGDLTL
AAAIAGGCEFIAIPEVEFKRDDLVAEIKAGIAKGKKHAIVAITEKLDDIEELAKYIEKET
CRETRGTVLGHIQRGGAPVAYDRILASRMGAYAVDLLLEEDRDYSQGGFCVGVENEKMVH
ELISICIAPENKKSKFKEDWYDTAKKLF
NT seq 987 nt NT seq  +upstreamnt  +downstreamnt
atgatcaaaaaaattggtgtactgacaagtggtggcgatgccccaggcatgaatgctgcg
atccgtggcgttgtccgcgccgctttatctgcagatttggaagtctacggtattgaagat
ggctacctcggcatgtatgaaaaccgcatgcgcaaactggatcgctacagcgtctccgat
atgatcaaccgtggcggtactttcctgggttcagcacgtttcccggaattccgtgatcca
gaaatgcgtaaagttgcgctgcagaatatgaaagaccgtggtatcgatggccttgtggtt
atcggcggtgacggttcatatgccggtgcagacctgctgaccaaagaaggtggcatccgt
tgcatcggcctgccaggcacaatcgataacgacgttgcgggcactgactacactatcggt
ttcttcacggcgctgggtacagtggttgaagccattgaccgtttacgtgatacctcctct
tcacaccagcgtatctctattgttgaggtgatgggccgttattgcggtgatttgacctta
gcagcagcgattgccgggggttgcgaatttatcgctatccctgaagttgaattcaaacgt
gatgatctggttgctgaaatcaaagccggtatcgcgaaaggcaaaaaacatgccatcgtt
gccatcaccgagaagttagatgacattgaagaactggctaaatacatcgagaaagaaacc
tgtcgtgaaacgcgtggcacggtattaggtcatattcagcgtggcggcgcacctgtcgct
tatgaccgtattctggcttcccgcatgggtgcgtatgctgttgacctgttgctggaagaa
gatcgtgactattctcagggcggtttctgcgtgggtgttgaaaacgagaaaatggttcac
gaactcatctcgatttgtatcgcgccagagaacaagaaaagcaaatttaaagaagactgg
tacgacacggcgaaaaaacttttctga

DBGET integrated database retrieval system