KEGG   Rahnella aquatilis HX2: Q7S_22926Help
Entry
Q7S_22926         CDS       T01850                                 

Definition
(GenBank) hypothetical protein
Organism
raa  Rahnella aquatilis HX2
SSDB OrthologParalogGene clusterGFIT
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
PRA1:38232..38639
Genome map
AA seq 135 aa AA seqDB search
MPYGDNGQGLFRRGQLEQQIIRTTKFSIYAQAVYCVNRMLREANVGISEQAYQSISRNIT
AVTNGRLYETSASLSEARVFARDTAGAIKAGDFKSAAITASGAAINAIGGPLFFGHYDRN
KLMAIERHLYDNFHL
NT seq 408 nt NT seq  +upstreamnt  +downstreamnt
atgccatacggtgataatggtcagggactctttcgcagagggcagcttgagcaacaaata
atcagaaccaccaagttctcgatttacgcgcaggcggtgtattgcgttaacagaatgctg
cgcgaggccaatgtcggtatttcggagcaggcgtaccaaagcatctcacgcaatattact
gcggtgacaaacggacgcctttacgaaacatcggcttcactttcagaagcgcgggtattt
gcacgtgatactgcgggggcgataaaagccggtgattttaaatcggcggcgatcacagcc
agtggcgctgcgatcaacgccattggcgggccgctgttttttggtcattatgaccgtaac
aaactgatggcgatagaacgccatctgtacgataacttccacctgtaa

DBGET integrated database retrieval system