KEGG   Rahnella aquatilis HX2: Q7S_23021Help
Entry
Q7S_23021         CDS       T01850                                 

Definition
(GenBank) BadM/Rrf2 family transcriptional regulator
  KO
K19587  Rrf2 family transcriptional regulator, repressor of oqxAB
Organism
raa  Rahnella aquatilis HX2
Module
raa_M00767  Multidrug resistance, efflux pump OqxAB
Brite
Transcription factors [BR:raa03000]
 Prokaryotic Type
  Helix-turn-helix
   Rrf2 family
    Q7S_23021
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Rrf2
Motif
Other DBs
NCBI-ProteinID: AFE60766
UniProt: H8NZS6
Position
PRA1:complement(64174..64659)
Genome map
AA seq 161 aa AA seqDB search
MLDYRFPTAMQMVFCIAQSQKAGQRCTSAILATGLEANSSFIRKLMVPLTQHGIIVSTLG
RTGSITLGRPAEEITLRDIYCAVIEDKRLWAARPDVPARCVVSANACTYFKNIVSEAEEA
SFQVLARHTVADALAEFERGGKYKCTKDLAAQNPEDSLCLK
NT seq 486 nt NT seq  +upstreamnt  +downstreamnt
atgttagattatcgctttccgacagctatgcagatggtgttttgtatcgctcagtcccaa
aaggctggccagcgctgcaccagtgcgattttagcaacgggtctggaagccaactccagt
tttatccgcaaactgatggtgccactgactcagcatggcattatcgtctccacacttggt
cgcaccggctcgattacacttggccgtccggcggaagaaatcacacttcgtgatatttat
tgcgcggtgattgaagataaacgtctgtgggcagcgcgcccggacgtgcccgcccgctgt
gtggtcagcgccaatgcctgcacctatttcaaaaacattgtcagcgaagccgaagaagcg
tcgtttcaggtgttagcccgtcataccgttgcggatgccctggctgagtttgaacgcggt
ggcaaatacaaatgtaccaaagatttagcggcgcaaaacccagaagattcgctctgtttg
aaatag

DBGET integrated database retrieval system