KEGG   Rahnella aquatilis HX2: Q7S_23096Help
Entry
Q7S_23096         CDS       T01850                                 

Definition
(GenBank) phage tail tape measure protein, lambda family
Organism
raa  Rahnella aquatilis HX2
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
PRA1:complement(79113..81542)
Genome map
AA seq 809 aa AA seqDB search
MSQAVGDLVVSLDVDAAKFKEQVEFARKQLGGLGDAAQKAEGQAVQSFTKQEIAARRADL
SMGQYTNAVRMLPAQFTDVATQLAGGQSPWLILLQQGGQVKDSFGGVSNVAKILLTYITP
LNAAIGAGAAVFGVLAISVYKSRQEIAEASKIINDSLGLSGDSASQLALNMRGISEASGE
SIKSVSELFITTKDGADVAIEKMISVGFTYQDAKDKVNEYKNSSNFTALNSDIENHKLKV
LGIKAAWGEAEQGVKNYYTGVNSGKQSLALGGAIDPIVALMEQAKQLRGDLAKATIDGNL
ATQKNVEWITKEYLATDRVAGAEARLKESREISKKIAFSGDTVAISNAQKLITLREKEVE
AAKKSQEPKKEKGVTVAPGDRASDTVNAETLALQTQLKVLQQHAGANETISQQRKNLWEA
EAKFSVLDDAAKNRALSKDEQSLLANKNSVLAQAKINAKLGDQIVAQQDLTKLQEALRGR
EGKTLDLTKQRFDLLERLKAQGGISPAEYDKTSVDVANKSITAMPRDLQKTSKKGDALNG
VSGTFGNDLNQLSKLDQQSTDLQNWYQSNLTALAEYRQQRSDLNAQWDAQELALRQKQSQ
AEQSLEQQKNSIIQNAVQSSLGSVVDITRTAFGEKSAIYKASFIADKAYAVAQSMLAIQT
GIALAVANPFPANLVAMASVAAATASLVSNIQSIGLTGMAHSGIDAVPETGTWLLQKGER
VMTSQTSAKLDATLENMQIQRAESPGGYNYSPTIQVNGDPDQRTLLLIESAVSRGAKQGY
DLVTSHIASGRGNVSKALGSGWSTKRRTN
NT seq 2430 nt NT seq  +upstreamnt  +downstreamnt
atgtcccaggcggtgggtgatcttgttgttagcctcgatgttgatgcggcaaagtttaaa
gagcaggtcgagtttgcccgtaaacaactcggaggattgggtgacgctgcgcaaaaagcc
gaggggcaagctgtacagtcatttacgaaacaagaaattgcagcacgacgggctgatctg
tctatgggccagtacaccaatgctgtgcgcatgctccccgcccagttcacggacgtggcc
actcagttggccggcgggcaaagtccgtggttaatcttactccagcagggcggccaggtt
aaagactcctttggcggtgtaagcaatgtcgccaaaatattgctgacctatatcaccccg
cttaatgcggcgatcggggccggtgcggccgttttcggtgtgctggcgatatctgtttat
aagtcccggcaggaaatcgctgaggctagcaagatcatcaacgattcgttgggattaagt
ggtgacagcgcatcacagctggcgcttaacatgcgggggatttctgaggcgtcaggcgaa
tcaataaaaagcgtttctgagctatttatcaccaccaaagatggtgccgacgttgccatt
gagaaaatgatatctgtcggttttacgtatcaggatgctaaagacaaggttaatgaatat
aaaaattcatcgaactttactgccttaaactcggatattgaaaaccataagctcaaagtc
ttaggcatcaaagctgcctggggagaagcggaacagggggtaaaaaactattataccggc
gttaactcaggtaagcagagccttgcgctgggcggtgcgatcgatccgatagttgcgctg
atggagcaggccaaacaactgaggggcgatctcgctaaagccaccattgatgggaaccta
gcaacgcaaaagaatgttgagtggatcaccaaggaatatctggctactgacagggttgct
ggcgctgaagcccgattaaaagaatcccgagaaatctcgaagaaaatagcattttcaggt
gatacggtcgcgatatcaaacgcgcaaaagttgattacgttgcgcgaaaaggaagtagag
gcggccaaaaaaagccaggaaccgaaaaaggagaaaggcgttactgtcgcccctggcgat
cgagcctccgatacggtaaatgctgaaactttagcgttacaaacacagcttaaagttctt
cagcagcatgccggcgcgaatgaaaccatcagccaacagcgtaaaaacttatgggaagcg
gaagcaaagttctctgtcctggacgatgccgcaaagaatcgggcattaagtaaagatgag
caatcactgttagcgaataaaaactccgtgctcgcccaggctaaaatcaacgccaaattg
ggcgatcagattgtcgcccagcaggatttaacaaaattacaggaggcattgcgcggcagg
gaaggaaaaacgctggatttgacaaagcagcgttttgatttgctggagcgattaaaggcg
cagggcgggatatcgccggctgagtacgataaaacctccgttgatgtggcgaataagtca
atcacggcgatgccacgggatttgcagaaaacatcgaagaaaggcgatgcgctcaatggc
gtgtcgggcacctttggcaatgacttgaatcagctttcgaaattggatcagcagtcaacc
gacctgcagaactggtatcaaagcaacctcacagcactggcagaataccgccaacagcgg
tcagatctgaatgctcaatgggacgctcaggaactggcgctaagacaaaaacagtcacag
gcagaacagtctcttgaacaacagaaaaatagcattattcagaatgccgttcagtccagc
ctgggctctgttgtggatattacccgtaccgcatttggtgaaaaatcggcaatttataaa
gcctcgtttattgctgataaagcctacgcggtcgcacagtcgatgttggctattcaaaca
ggtatcgcgctggccgtcgccaacccctttcctgcgaaccttgttgctatggcatcggtt
gccgccgctacggcgagtttggtttcgaatattcaatctatcggactgaccggtatggct
cactccggcattgatgccgttcctgaaaccgggacgtggttgttgcagaaaggcgagcga
gtcatgacatctcagacgtcggcaaaactcgatgccactttggaaaatatgcagatccag
cgcgctgaatctcccggtggatataattattcaccgactattcaggttaacggtgatcct
gaccagcgcacgcttttgctcattgaaagcgcggtatctcgaggggcaaaacaaggctat
gacttagtcacgtcacatatcgcctccggtcgtgggaatgtatcgaaagcgttggggagt
ggctggtctacaaagcgaagaaccaattaa

DBGET integrated database retrieval system