KEGG   Rahnella aquatilis HX2: Q7S_23116Help
Entry
Q7S_23116         CDS       T01850                                 

Definition
(GenBank) Major tail protein V
Organism
raa  Rahnella aquatilis HX2
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
PRA1:complement(82617..83033)
Genome map
AA seq 138 aa AA seqDB search
MTTPNPLAPVKGARTTLWLYTGNGDPYANPLLDVGWTRLAQIKDLTPGELTADSYDDSYL
DDDNADWTSTSQGQKTAGEASFTLAWKPGETGQQGLNTWFDEGTDKTYKIMFPNGAVDVF
TGAVGAKQYPPMKRSPAQ
NT seq 417 nt NT seq  +upstreamnt  +downstreamnt
atgacaacaccgaaccccctcgcgccggttaaaggcgcccgcacaacattatggctttat
accggtaacggtgacccctacgctaatccgctcttagatgttggctggacccgtctggcg
caaattaaggacctgactccgggcgaactgaccgccgattcttatgatgactcttatctc
gatgatgacaacgcggactggacatcgacatcacagggccagaagacggcaggtgaggcc
agttttaccctggcatggaagcccggcgaaacagggcagcaagggttgaatacctggttt
gatgaaggcacagataagacgtacaaaattatgttccctaacggcgcggtagacgttttt
acgggagcggtcggggcaaagcagtacccgccaatgaagcgatcacccgcacagtga

DBGET integrated database retrieval system