KEGG   Rahnella aquatilis HX2: Q7S_23331Help
Entry
Q7S_23331         CDS       T01850                                 

Definition
(GenBank) methyl-accepting chemotaxis sensory transducer
  KO
K05876  
methyl-accepting chemotaxis protein III, ribose and galactose sensor receptor
Organism
raa  Rahnella aquatilis HX2
Pathway
Two-component system
Bacterial chemotaxis
Brite
KEGG Orthology (KO) [BR:raa00001]
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    Q7S_23331
 Cellular Processes
  Cell motility
   02030 Bacterial chemotaxis
    Q7S_23331
Bacterial motility proteins [BR:raa02035]
 Flagellar system
  Chemotaxis proteins
   MCPs
    Q7S_23331
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
PRA1:complement(118976..120523)
Genome map
AA seq 515 aa AA seqDB search
MSLKKSSLLVLVILFALFFTSMLSNVWLLTRSNHSLDDVNKEIRVVLSIIDPINHSRTSR
VRVMEYMKEIENGDGQQSKSALDGVTEVIGKADAAFQTYLDVPKLPGESELADEYRNTYQ
DYRQNGIQPLIDAAKSGDQAAFKARIPAVVKLDRQYEIVLDKVLALHEQYAKNLNNVAQS
HFKFGIGLTVGFGLLFLIIIISVLVLMKRFVLLPLLSSRDHCRQIAEGYLDTPVPVKAKS
RSEIEELMQSIEHMRQSLTRIIRQVRDTSHTVAHASQEISAGNIDLASRTEQQAAALTQT
AASMEELGATVKQNTENVSRASSLTREAVQNARAGEKVAQDVIGTMGRINSSSKKIEDIT
GVINSIAFQTNILALNAAVEAARAGEQGRGFAVVASEVRSLAQRSAMAAKEIESLISESV
ANIREGSDEVSRTGDSISAIISSVTQINILMEHISIASDEQSRGISQIEQAVTEIDGVTQ
QNAALVQESAAAAASLEEQVLHLTRSVSAFRLATV
NT seq 1548 nt NT seq  +upstreamnt  +downstreamnt
atgtcgcttaaaaagtcgtctttacttgttcttgttattcttttcgcactctttttcacc
agtatgctttcgaatgtttggctgctcacccggagtaatcattcactggatgatgtgaac
aaggaaatccgtgtggtgctttctattatcgaccccattaaccacagccgaacctcgcgt
gttcgcgtgatggaatatatgaaagaaattgaaaatggagacggtcagcagtcaaaatct
gctctggacggagtcactgaggtcatcggtaaagccgatgcggcgtttcagacgtatctt
gatgtgccgaaattgcctggtgaaagtgaactggccgatgaataccgcaatacgtaccag
gactatcgccagaacggtatccagcccttgattgacgctgcaaagtccggtgatcaggca
gcgttcaaagcccggatccctgcggtggtgaaactcgatcgtcagtatgaaatcgtgttg
gataaagtgttggccctccatgaacagtacgcaaaaaatcttaataatgttgcacaaagt
catttcaaatttggtatcggtttgacggtcggttttggtttgttatttctgatcatcatt
atcagtgttctggtgttaatgaagcgctttgttctgctaccgctgctgagttctcgcgat
cactgccgtcagattgctgaaggttatctcgatacgccagtaccggtgaaggccaaatcc
cgcagtgagattgaagagttgatgcagtcgatagaacatatgcgtcagtcgctgaccaga
attataaggcaggtacgcgacaccagccataccgtggcgcatgcatcgcaggaaatctcc
gcaggtaatattgatctggcttcccgcactgaacaacaggccgcagcgctgacacaaacc
gccgccagcatggaagaacttggtgcgacggtaaaacaaaataccgaaaatgtctcccgg
gcaagcagtctgacacgtgaagctgtccaaaacgcgcgcgcaggcgagaaagtcgctcag
gacgtgattggtacgatggggcgtattaacagcagttcgaaaaaaatcgaagatattaca
ggtgtgatcaatagtatcgcttttcagacaaacattctggcgctcaatgccgctgttgaa
gcggcacgcgcgggtgagcaggggcgtggatttgcagtggtggccagtgaagtgcgcagt
ctggcgcagcgcagcgccatggcagcaaaagaaatcgaaagtctgatttctgaatcggtg
gcgaatattcgcgaagggtcggatgaggtctcacgcaccggcgattccatttcagcgatc
atttcctctgtcactcagattaatatattaatggaacatatctcgatagcctctgatgaa
caaagccgcgggattagccagattgaacaggcggtgacagaaattgatggcgtgacgcaa
caaaacgcagcgctggttcaggaatcggctgccgcagcggcctcgctggaagaacaggtt
cttcatctgacccgctcagtatcagcgttcagactggcaacagtgtaa

DBGET integrated database retrieval system