KEGG   Rahnella aquatilis HX2: Q7S_23496Help
Entry
Q7S_23496         CDS       T01850                                 

Definition
(GenBank) cytochrome d ubiquinol oxidase, subunit II
  KO
K00426  
cytochrome bd ubiquinol oxidase subunit II [EC:1.10.3.14]
Organism
raa  Rahnella aquatilis HX2
Pathway
Oxidative phosphorylation
Metabolic pathways
Two-component system
Module
Cytochrome bd ubiquinol oxidase
Brite
KEGG Orthology (KO) [BR:raa00001]
 Metabolism
  Energy metabolism
   00190 Oxidative phosphorylation
    Q7S_23496
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    Q7S_23496
Enzymes [BR:raa01000]
 1. Oxidoreductases
  1.10  Acting on diphenols and related substances as donors
   1.10.3  With oxygen as acceptor
    1.10.3.14  ubiquinol oxidase (electrogenic, non H+-transporting)
     Q7S_23496
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
PRA1:161350..162357
Genome map
AA seq 335 aa AA seqDB search
MGIDLPLIWFLIIIFGVMMYVVMDGFDLGIGLLFPLVKKEHDRDVMMNTVAPVWDGNETW
LVLGGAALYGAFPLAYSVILDALTIPLTLMLFGLIFRGVAFEFRFKASPAKRHVWDKSFI
WGSVIATFCQGVVLGAVINGIPVVNRTYAGGALDWLTPFTLFCGFALVVAYALLGCTWLI
MKTEGELQEAMHKIAKPLLLVFLLVTLAVSLWTPLTHSDIATRWFSRPNLYWFLPVPVLV
VLVSAWMYRAISKNAHHAPFLLTLALVFLGYTGLGISIWPNIIPPSISIWEAASPPQSQG
FILVGALFIIPIILVYTFWSYYVFRGKVTPDQGYH
NT seq 1008 nt NT seq  +upstreamnt  +downstreamnt
atgggtatcgacttaccgctgatctggtttttgatcatcatcttcggcgtgatgatgtat
gtggtgatggacggattcgacctgggtatcggcctgctattcccgctggtgaaaaaagaa
cacgaccgtgatgtgatgatgaacaccgttgcgccggtctgggacggcaacgaaacctgg
ctggtgctcggcggtgcggcattgtatggcgcattcccgctggcgtactcggtgattctg
gatgcactgactatcccgctgaccctgatgctgttcggtctgattttccgtggcgtagcc
tttgaatttcgtttcaaagccagtccggccaaacgtcacgtgtgggacaaatctttcatc
tggggttcggtgatcgccaccttctgtcagggcgtggtgctgggcgcggtgatcaacgga
attccggtggtgaaccggacttatgccggtggcgcactggactggctgacgccgttcacg
ctgttctgtggttttgcgctggtggtggcttatgccctgctcggctgcacctggctgatt
atgaaaaccgaaggcgaattgcaggaagcgatgcacaaaatcgctaaacccctgttgctg
gtattcctgctggtgacgcttgcagtcagcctgtggacgccactgacccacagcgatatc
gccacccgctggttctcgcgccctaatctttactggttcctgccggtaccggtgctggtg
gtgctggtctccgcatggatgtatcgcgccatcagcaaaaatgcgcatcacgcgccgttc
ctgctgacgctggcgctggtgttcctcggctataccggtctggggatcagcatctggccg
aacatcattccgccgtccatttctatctgggaagcggcttcaccgccgcaaagccagggc
tttattctggtcggcgccctgttcatcatcccgatcattctggtgtacaccttctggagc
tactacgtgttccgcgggaaagtcacaccggatcagggttatcactga

DBGET integrated database retrieval system