KEGG   Rahnella aquatilis HX2: Q7S_23506Help
Entry
Q7S_23506         CDS       T01850                                 

Definition
(GenBank) TetR family transcriptional regulator
Organism
raa  Rahnella aquatilis HX2
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
PRA1:complement(162766..163344)
Genome map
AA seq 192 aa AA seqDB search
MKENREALRAKILDGAISLFIEKGIEKVTTRELTEYVGISRSHIYHYFPDWQTLCVEALS
VVMMAELKEFSAEISPLEPKAKLHTLVCNYLPDTQGDIWQLYGSLWQLAAHNEAYAELAR
LMVHKWLALLADIIRAGIDSGVFRPTDAGRVTRQLSAIMNGYSDQLIVMPSAAARQEAMD
DILDFIGRVLEK
NT seq 579 nt NT seq  +upstreamnt  +downstreamnt
atgaaagaaaaccgggaagcgttaagggctaaaattcttgacggagccatcagtctcttt
atcgaaaaggggattgaaaaagtcacgacgcgcgagctgacggagtacgtcgggatttcc
cgcagccacatttatcattattttcctgactggcagacgctgtgcgttgaagcgctgtcg
gtggtgatgatggcggagctgaaagagttttccgctgaaatttcaccgcttgagcccaaa
gcaaaattacacacgctggtgtgcaattatctgcccgatacgcagggcgatatctggcag
ttgtatggttcgctgtggcaactggcggcgcataatgaggcttacgccgaactggcgcgg
ctgatggtgcataagtggctggcgctgctggccgacattatccgcgccgggatcgacagc
ggcgtgttccgcccgaccgatgccggacgcgttacccgccagttgtctgccatcatgaat
ggctattccgatcagctgatcgtcatgccttccgccgccgcacgtcaggaagcgatggac
gatattctcgattttatcgggcgggtgctggagaaataa

DBGET integrated database retrieval system