KEGG   Riemerella anatipestifer RA-CH-2: G148_0117Help
Entry
G148_0117         CDS       T02438                                 

Definition
GTP cyclohydrolase I
Orthology
K01495  
GTP cyclohydrolase I [EC:3.5.4.16]
Organism
rae  Riemerella anatipestifer RA-CH-2
Pathway
Folate biosynthesis
Metabolic pathways
Module
Tetrahydrofolate biosynthesis, GTP => THF
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:rae00790]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
126256..126921
Genome map
AA seq 221 aa AA seqDB search
MNNHFDNDDDVFTGKEHTPLRADAFEKTPEEKIAIIEKHFAEIMQTLGLDMTDDSLKDSP
KRVAKMYVNEIFGGLLPENKPGISTFSNKYKYRQILVEKDITVYSFCEHHFLPIIGRAHV
AYISNGEVIGLSKINRIVDYYAKRPQVQERLTMQIVDALKEALGTNDVACIIDAKHLCVN
CRGIKDTASSTITAELSGIFRTNPITRQEFLHYVGSHAKLD
NT seq 666 nt NT seq  +upstreamnt  +downstreamnt
atgaacaaccattttgataatgatgacgatgtgtttacaggcaaagagcacacaccctta
agagctgatgcctttgagaaaacacctgaagaaaaaattgccattatagagaagcatttt
gccgaaatcatgcaaactttagggctagatatgacggatgattccctaaaagactctcct
aagcgagtagccaaaatgtatgtaaatgagatttttggaggactacttcctgaaaacaaa
ccaggtatctctacttttagcaacaagtataaatacagacaaatactcgttgaaaaagac
attacagtttattctttttgtgagcatcattttttgcctatcattggcagagcccatgtg
gcttatatctctaacggagaggtgattgggttatccaaaatcaatagaattgtagattac
tatgccaaacgcccacaagtgcaagaaagactcactatgcaaatagtagacgctctaaaa
gaggctctcggcactaatgatgtggcttgtattattgatgctaagcacctttgtgttaat
tgtagaggcatcaaagacacggctagttctaccattacagcggaacttagcggcatcttt
agaactaaccctatcactagacaagagtttctgcactatgttggtagtcatgcaaaacta
gattaa

DBGET integrated database retrieval system