KEGG   Riemerella anatipestifer RA-CH-2: G148_0238Help
Entry
G148_0238         CDS       T02438                                 

Definition
hypothetical protein
Orthology
K01719  
uroporphyrinogen-III synthase [EC:4.2.1.75]
Organism
rae  Riemerella anatipestifer RA-CH-2
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:rae00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    G148_0238
Enzymes [BR:rae01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.75  uroporphyrinogen-III synthase
     G148_0238
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
232304..232963
Genome map
AA seq 219 aa AA seqDB search
MASSILLTKEINPEKRQLLLNEGLEVDTKDFIRIKFINTEKISLRNKTLIFTSANGVEGF
FKNGFDAPHSSVICVGGKTESKLAEKGIKTLHTAKNAEELASFILQQQWDNPDFVHFCGN
LALDTLEKSIANHNANYIKKIVYETELLYPTLNKKYDALVFFSPSGVRSFVKNNSITDEM
VFCIGNTTALEVAKYTSQKPIISTKQNLNDLLSLVKSVV
NT seq 660 nt NT seq  +upstreamnt  +downstreamnt
atggctagttctattctcttgactaaggaaatcaatcctgaaaaacgccaactcctgtta
aacgaaggactagaggttgataccaaagattttattagaattaaattcatcaataccgaa
aagattagtctgcgtaataaaacacttatattcactagtgcaaatggggtagaaggcttt
tttaaaaacggttttgatgcacctcattcatctgtgatttgtgtaggtggcaaaactgaa
agcaaacttgcagaaaaaggcatcaaaactctacatacggctaagaatgccgaagaatta
gcctcgtttatacttcaacagcaatgggataatcctgattttgttcacttttgtggcaac
cttgcattggatactttagaaaaaagcatcgctaatcacaatgcgaattatataaagaaa
atagtttacgaaaccgaacttctataccctactcttaacaaaaaatatgatgctttagtt
ttttttagtccaagtggagttcgtagctttgtaaaaaataattctataaccgatgaaatg
gtcttttgtataggaaatactaccgctttggaagtggcaaaatacacctcacagaaacct
ataattagcaccaagcaaaacctcaacgatttgcttagtctagtaaaatcggtagtctaa

DBGET integrated database retrieval system