KEGG   Riemerella anatipestifer RA-CH-2: G148_0874Help
Entry
G148_0874         CDS       T02438                                 

Definition
hypothetical protein
Orthology
K01953  
asparagine synthase (glutamine-hydrolysing) [EC:6.3.5.4]
Organism
rae  Riemerella anatipestifer RA-CH-2
Pathway
Alanine, aspartate and glutamate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:rae00001]
 Metabolism
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    G148_0874
Enzymes [BR:rae01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.4  asparagine synthase (glutamine-hydrolysing)
     G148_0874
Peptidases [BR:rae01002]
 Cysteine Peptidases
  Family C44
   G148_0874
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
928386..930275
Genome map
AA seq 629 aa AA seqDB search
MCGINGLILKDINSDSAIKKLKIMNQRIFHRGPDEDGLFVEQTGQNVVGFAMRRLSIIDL
SNGKQPIFSEDRTKVIVFNGEIYNYQSLRKQLLSVGKTFKTNSDTEVILRLYEVYGKAAF
KMLDGMFAFSIYDKSINKIFIARDFFGEKPLYYQNSEKGLIWCSELKSLMSVSEEERVIS
KEGLNLYFQLTYIPAPFTIYEGIYKLEPNHFIEYDLVANEFRLEKIHIEGKFDKRDLSFD
DAKKELRDLVKESVLSRSISDVPLGTFLSGGVDSSIVTVCLAEEMEQKINTFSIGYDKKS
FDESDKSKIVAKQIGSIHHQFILKEQDLEDEITSVLQNFDEPFADSSALPSFFVAKKTSE
YVKVALTGDGGDEIFGGYNKYLIGKINERYTQIVPKALHCTIKKVSDFLTKQKEDQRGLK
FKVRKAVNAIDYGGEFYYNMVKLGFQEPELSRFLRKEWLVKDALSLYKERIPNPKTLNDF
RNVDRMISLEGDMIVKVDRTSMLTSLECRAPFLNKKLWDYSHTLPKHYLLNGNNKKYILK
KAFEDKFPEGFLEKSKKGFGVPVGDWLKSTLKEELMSYVVTEKLEKQGLFNVLEIQKLVY
NHLNEIEDNTFRVWTLYCFQKWYFNMHLE
NT seq 1890 nt NT seq  +upstreamnt  +downstreamnt
atgtgcggtattaatggacttattttaaaagatataaattctgattcagcgataaagaaa
ctgaagataatgaaccaacgaatttttcatcgtggaccagatgaagacggtctatttgtg
gagcaaacgggacaaaatgttgtagggtttgctatgcgtaggctctctattattgatttg
tctaatggtaagcaacctatattctcggaagataggactaaagttattgtttttaatggt
gaaatttataattatcaaagtttaagaaagcagcttttatccgtaggaaaaacctttaaa
acgaattctgataccgaagttatactaaggttatatgaagtttatgggaaagcagcattt
aaaatgttagatggaatgtttgctttttctatttatgataagtctattaacaagatattt
atagcaagagatttctttggggagaagcctctgtattatcagaattcagaaaaaggactt
atttggtgttcagaattaaaatctttgatgtcggtttcagaagaagaacgagttatttct
aaagaaggattaaatctttactttcagttgacttatatacccgcaccttttacgatttat
gagggaatttataagttagagcccaatcactttatagagtatgatttggttgcgaatgaa
tttagattagaaaaaatacatattgaaggtaaatttgataagagagacctttcatttgat
gacgctaagaaggaattgagggatttggtaaaggaaagtgttctttctagaagcatttca
gatgtccctttaggtacttttttgtctggtggagtagattcttctattgtaacggtttgt
ttagctgaagaaatggagcaaaagattaatactttttctattggctatgataaaaaatcg
tttgacgagtcagataaatcaaaaattgtggccaagcaaataggctctatacatcatcaa
tttatacttaaagaacaagatttagaagacgaaataacttctgtactacagaattttgac
gagccgtttgcggactcttctgcattgcctagtttttttgtggcaaaaaaaactagtgaa
tatgtaaaagtagctctgacaggagatggtggagatgaaatttttggaggatataataaa
tacctcatagggaaaataaatgaaaggtatacgcaaatagtgccaaaggctttgcattgt
acgattaaaaaggtatcagactttttaactaaacaaaaagaggatcagcgcggactgaag
tttaaagtgcgaaaagcagttaatgccattgactacgggggagagttttactataatatg
gttaagttaggttttcaagagcctgaactatcacgttttcttaggaaagaatggttagta
aaagatgctttgagtctttacaaagagagaatacctaatcctaaaacacttaacgatttt
cgtaatgtggatagaatgataagtttggaaggagatatgattgtaaaagtggataggaca
agtatgttgacttcgttggaatgtagggcgccctttttaaataaaaaactttgggattat
tctcacactcttccaaagcattatttgcttaatgggaataataaaaagtatatactaaag
aaggcttttgaggataaatttccagaaggttttttagagaaatcaaagaaaggttttggg
gtacctgttggggattggttaaaatctacacttaaagaggaattaatgtcttacgtagta
acagagaaattggagaaacaaggcctttttaatgttctagaaatccaaaaattagtttac
aatcatttaaatgaaatagaagataatacatttcgtgtttggacgctttactgctttcag
aagtggtattttaatatgcatttagagtaa

DBGET integrated database retrieval system