KEGG   Riemerella anatipestifer RA-CH-2: G148_0885Help
Entry
G148_0885         CDS       T02438                                 

Definition
Dihydrofolate reductase
Orthology
K00287  
dihydrofolate reductase [EC:1.5.1.3]
Organism
rae  Riemerella anatipestifer RA-CH-2
Pathway
One carbon pool by folate
Folate biosynthesis
Metabolic pathways
Module
Tetrahydrofolate biosynthesis, GTP => THF
Brite
KEGG Orthology (KO) [BR:rae00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    G148_0885
   00670 One carbon pool by folate
    G148_0885
Enzymes [BR:rae01000]
 1. Oxidoreductases
  1.5  Acting on the CH-NH group of donors
   1.5.1  With NAD+ or NADP+ as acceptor
    1.5.1.3  dihydrofolate reductase
     G148_0885
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(939513..940004)
Genome map
AA seq 163 aa AA seqDB search
MTTIIVAMGKNNEIGFNNQLLWHLPKDLKHFKNLTSGHPIIMGRKTYESIGKPLPNRTNI
VVSQKKDWFEEGILIVGTLKEAIKFAKKIDENIFIIGGGSIYEQTIDQADRLEVTLVDTT
LKADTFFPKINPKEWLKTDEICHEKDEQNPYNFCFQTYERVQK
NT seq 492 nt NT seq  +upstreamnt  +downstreamnt
atgaccaccatcattgtagcaatgggtaaaaataatgaaataggctttaataaccaactt
ctttggcatttacctaaagatttgaaacacttcaaaaatttaacctcagggcaccctata
attatggggcgaaaaacctatgaaagcattggaaaacctctacccaacagaactaatatc
gtggttagtcaaaaaaaagattggtttgaggaaggtattctgattgttggtactttaaag
gaagctattaaatttgccaagaaaatagacgaaaatattttcatcatcggtggtggcagc
atttatgaacagaccatagaccaagcagaccgactggaagtaactttagtggataccact
ctaaaggcagatacctttttcccaaaaatcaacccaaaagaatggctaaaaactgatgaa
atttgccatgaaaaggacgagcaaaacccttataatttttgctttcaaacttatgaaaga
gtacagaaataa

DBGET integrated database retrieval system