KEGG   Riemerella anatipestifer RA-CH-2: G148_1391Help
Entry
G148_1391         CDS       T02438                                 

Definition
(RefSeq) Indole-3-glycerol phosphate synthase
  KO
K01609  
indole-3-glycerol phosphate synthase [EC:4.1.1.48]
Organism
rae  Riemerella anatipestifer RA-CH-2
Pathway
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:rae00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    G148_1391
  Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    G148_1391
Enzymes [BR:rae01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.48  indole-3-glycerol-phosphate synthase
     G148_1391
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
Position
1472548..1473324
Genome map
AA seq 258 aa AA seqDB search
MTILDKIVDCKLDEIQQAKKQTPLEKLKDTPFFYQPTRGFIESLKSNPYGIIAEFKRKSP
SKNNINIEAKIQAILPLYKAYGAACVSVLTDTPFFGGSLTDLEEANAYDIPLLRKDFIVD
DYQIYQAKAHGADCILLIANILSKSQIEDLTDTAHHLGLDVLLEFYSGEDFDKYYSKLKM
VGINNRNLNTFEVDYEHAIRMRNQLPEDTLSVAESAIYSPEIYKKLKNNGFEAFLMGEYF
MKQDHVGAALQSFIEEIK
NT seq 777 nt NT seq  +upstreamnt  +downstreamnt
atgaccattttagacaaaatagtagattgtaagctggacgaaattcagcaagccaaaaag
cagacgccgttagaaaaactcaaggacactccgtttttctatcagcctacacgaggtttt
attgagagtttaaaatccaatccgtatggaattatagccgagtttaaaaggaaatcgccc
tctaaaaacaacatcaacatagaggctaaaatccaagcgattttaccgctatataaggca
tacggagcggcttgtgtgtctgtattgacggatacgcctttcttcgggggaagtttaacc
gatttggaagaagccaatgcttacgatatacctttgctaaggaaagactttattgtcgat
gattatcaaatttaccaagctaaagctcatggtgcagactgtattttacttatagccaac
attttgtctaaatcccagattgaagaccttacagatacagcacaccacttgggattagat
gtcttgttagaattttatagtggtgaagattttgataaatactattccaaattaaaaatg
gtaggcattaacaaccgaaacctcaatacttttgaagtggattacgagcacgccattaga
atgcgaaaccaattgcctgaagacactttaagcgttgccgaaagtgccatttatagtcct
gaaatttataaaaaactaaaaaacaatggttttgaggcttttttaatgggcgaatatttt
atgaagcaagaccatgttggagcggctttacaatcttttattgaagaaataaaataa

DBGET integrated database retrieval system