KEGG   Rickettsia africae: RAF_ORF0158Help
Entry
RAF_ORF0158       CDS       T00979                                 

Gene name
sdhD
Definition
Succinate dehydrogenase hydrophobic membrane anchor protein (EC:1.3.99.1)
Orthology
K00242  
succinate dehydrogenase membrane anchor subunit
Organism
raf  Rickettsia africae
Pathway
Citrate cycle (TCA cycle)
Oxidative phosphorylation
Butanoate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Citrate cycle (TCA cycle, Krebs cycle)
Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Succinate dehydrogenase, prokaryotes
Brite
KEGG Orthology (KO) [BR:raf00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    RAF_ORF0158 (sdhD)
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    RAF_ORF0158 (sdhD)
   00650 Butanoate metabolism
    RAF_ORF0158 (sdhD)
  Energy metabolism
   00190 Oxidative phosphorylation
    RAF_ORF0158 (sdhD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
168930..169310
Genome map
AA seq 126 aa AA seqDB search
MVYDFKAEIVKAKNSGSAKSGSHHWLLQRVTGIILALCSVWLIYFMLTNKNNDINIIMLW
ELKKPFNVVALLITVVISLYHAMLGMRVVIEDYISYHKLRNTLIIIVQLFCIVTIVAFVV
VLFYKG
NT seq 381 nt NT seq  +upstreamnt  +downstreamnt
atggtatatgattttaaagcagaaattgtaaaagcaaaaaatagcggttctgctaaaagc
ggttctcatcattggttattgcaaagagtaacggggattatattagctttatgttctgtg
tggctaatatattttatgttaaccaacaaaaataatgatataaatattattatgttgtgg
gaacttaaaaagccttttaatgtagtagctttgttaattacggtggttatttcgttgtat
catgcgatgcttggtatgcgtgtagtaattgaagattatataagttatcacaaattacgt
aatacattgattataatagtgcaattattttgcattgttactattgtagcttttgtagta
gtgctattttataaaggataa

DBGET integrated database retrieval system