KEGG   Rickettsia africae: RAF_ORF1033Help
Entry
RAF_ORF1033       CDS       T00979                                 

Gene name
paaJ
Definition
(GenBank) Acetyl-CoA acetyltransferase
  KO
K00626  
acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
raf  Rickettsia africae
Pathway
Fatty acid degradation
Synthesis and degradation of ketone bodies
Valine, leucine and isoleucine degradation
Lysine degradation
Benzoate degradation
Tryptophan metabolism
Pyruvate metabolism
Glyoxylate and dicarboxylate metabolism
Propanoate metabolism
Butanoate metabolism
Terpenoid backbone biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Fatty acid metabolism
Two-component system
Brite
KEGG Orthology (KO) [BR:raf00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    RAF_ORF1033 (paaJ)
   00630 Glyoxylate and dicarboxylate metabolism
    RAF_ORF1033 (paaJ)
   00640 Propanoate metabolism
    RAF_ORF1033 (paaJ)
   00650 Butanoate metabolism
    RAF_ORF1033 (paaJ)
  Lipid metabolism
   00071 Fatty acid degradation
    RAF_ORF1033 (paaJ)
   00072 Synthesis and degradation of ketone bodies
    RAF_ORF1033 (paaJ)
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    RAF_ORF1033 (paaJ)
   00310 Lysine degradation
    RAF_ORF1033 (paaJ)
   00380 Tryptophan metabolism
    RAF_ORF1033 (paaJ)
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    RAF_ORF1033 (paaJ)
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    RAF_ORF1033 (paaJ)
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    RAF_ORF1033 (paaJ)
Enzymes [BR:raf01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     RAF_ORF1033 (paaJ)
Exosome [BR:raf04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   RAF_ORF1033 (paaJ)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
complement(1058209..1059360)
Genome map
AA seq 383 aa AA seqDB search
MQRTTFGSFMGSLSTTAAPMLAAHLINDILQNSKIDPALVGEVILGQVITGGSEQNPARQ
TLIYAGIPKEVPGYTINKVCGSGLKSVVLAANSIMMDDNEIVIAGGRENMSLCMHGSYIR
AGAKFGDIKMVDLMQYDGLTDVFSGVFMGITAENISKQFNISRQQQDEFALSSHKKAAKA
QLAGVFKDEILPVEVTIKKTTSLFDHDETVRPDISLEILSKLRPAFDKNVVVTADNASSI
NDGAACLMVVSEEVLKKHNLTPLARIVSYASAGVDPSIMGTAPVPASKKALSKAGWSVND
LEVIEVNEAFAAQSIYVNREMKWDMEKVNVNGGAIAIGHPIGASGGRVLITLIHGLRRAK
AKKGLVTLCIGGGMGMAMCVEAV
NT seq 1152 nt NT seq  +upstreamnt  +downstreamnt
gtgcaaaggactactttcggctcgtttatgggtagccttagtacaacggctgcacctatg
cttgctgctcatttaataaatgatatactgcaaaacagcaaaatcgatccagctttagta
ggtgaggtaatcctaggacaggtaataaccggtggtagcgagcagaatccggcgaggcaa
actctgatttatgcgggaataccgaaagaagtgccgggctatacgattaataaagtatgc
ggctcaggtcttaaaagcgtagtacttgcagcaaattcaattatgatggatgataatgaa
atagttatagcaggtgggcgggagaatatgtcgctctgtatgcacggtagctatatcaga
gcaggagctaaattcggcgatattaaaatggttgatctaatgcagtatgacggattaacc
gatgtattttcaggagtatttatgggtattacagccgaaaatatctcgaaacagtttaat
attagcagacaacagcaggacgagtttgccttaagctctcacaagaaagcagctaaagca
cagctagcaggagtttttaaagatgaaatcttacctgtcgaagtaacgattaaaaaaact
actagtttgtttgatcatgatgaaacagtaagacctgatatcagccttgaaattctgagt
aaattacgtcctgcttttgataaaaacgttgtagttacagcggataatgcttcctctatt
aatgacggtgcggcatgtcttatggtagtttccgaagaagttttgaaaaagcataattta
acgccgctagctcgtattgtttcttatgcttcagccggtgttgatccaagtattatgggt
actgcccctgttcctgcatccaaaaaagctttaagtaaagcaggttggagcgttaatgat
ttggaagttatcgaggttaatgaggcgtttgccgctcaaagtatttatgtaaaccgtgaa
atgaaatgggatatggagaaggttaatgttaacggtggagcaatagccatcggtcatccg
atcggggcaagcggcggacgtgtacttattactctgatacacggcttacgcagagctaaa
gctaaaaaaggcttagttactttatgtatcggtggcggtatgggtatggctatgtgcgtt
gaagcggtttaa

DBGET integrated database retrieval system