KEGG   Riemerella anatipestifer RA-CH-1: B739_0046Help
Entry
B739_0046         CDS       T02331                                 

Definition
hypothetical protein
Orthology
K01201  
glucosylceramidase [EC:3.2.1.45]
Organism
rag  Riemerella anatipestifer RA-CH-1
Pathway
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:rag00001]
 Metabolism
  Lipid metabolism
   00600 Sphingolipid metabolism
    B739_0046
  Glycan biosynthesis and metabolism
   00511 Other glycan degradation
    B739_0046
Enzymes [BR:rag01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.45  glucosylceramidase
     B739_0046
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(46554..48044)
Genome map
AA seq 496 aa AA seqDB search
MKNIKLYIKGISIFTVLSCNAQTMSHIEIFETSARGNKLTKVEPQNPTKEVVKVKINPNK
TFQKILGFGGSFTESTAHLLTKLSLKNRAKIIEAYFGENGARYSLTRTTIASCDFSLKNY
TYAPVADDKELKHFSIQEDETALIPIIKEAQRISKDGFRIIASPWTPPPWMKDNNSWIDG
RLLPQYYDTYALYFSKYLSEYKKRGIDIWGVTVVNEPHGNGGNWESMQMSPKEMTNFVEF
NLAPKLNAEGFNKVKILGYDQNRAGLKEWVDEMYRSEKASDAFDGVAIHWYESTYDYFPK
ALDYAHHKNPNKYIIQTEACVDAEVPHWQDDDWYWSKEATDWGWDWAKEEEKYLHPKYVP
VFRYARDIIGCLNHHVNAWIDWNMVLDRQGGPNWFKNWCVAPVIVDEEKDDVYFTPIYYT
MAHFSRFIKPDAVRIEATHPDEELMLTAVENPDGSFVMAVFNPSEEKKNIEISVPKQNVY
SQIDAKAIQTIIIHKN
NT seq 1491 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaatataaaactttacataaaggggataagtattttcactgtattgagttgtaat
gcacaaacaatgagccatattgaaatttttgaaacttcagctcgtggtaataagcttacc
aaagtagaacctcaaaatcctactaaagaagttgttaaagtaaagattaacccaaacaaa
accttccaaaagatattaggttttggaggctcatttacagagagtaccgcacatctactc
acaaaattaagtctaaaaaatagagctaaaattatagaggcctattttggagaaaatgga
gcaaggtattctcttaccagaactaccatagcttcgtgtgatttttccttaaaaaactac
acttatgctcctgtagcagacgataaagagctaaagcatttttccatacaagaagacgaa
acggctttaattcctataattaaagaggctcagcgtatatccaaagatggctttagaatc
atagcctcgccttggacgccaccaccatggatgaaagataataacagctggatagatggt
cgccttttgccacaatactatgatacctatgctctttatttttcaaaatatctatcagag
tacaagaaaagaggaatagatatttggggcgtaacggtggttaacgaacctcatggtaac
ggtggtaattgggagagtatgcaaatgtctcctaaggaaatgacgaattttgtagagttt
aatctagctcctaaacttaatgcagagggctttaataaggtaaaaattctagggtacgac
caaaatagggcaggacttaaagaatgggtagatgagatgtatcgttcagaaaaagcgtca
gatgcgtttgatggtgtggcgatacattggtatgaaagtacttatgattatttcccaaaa
gctctagattatgctcatcataaaaaccctaacaaatatattatccaaaccgaagcctgt
gtagatgccgaagtgccacattggcaagatgatgattggtattggtctaaagaagccaca
gattgggggtgggattgggcaaaagaggaggagaaatatttacaccctaaatatgttcct
gtttttagatatgctagggacatcataggttgcctcaatcatcatgtaaatgcttggata
gattggaatatggtgctggatagacaaggaggtcctaattggtttaagaactggtgtgta
gcgcccgtgattgtggatgaagaaaaagatgatgtatattttacacctatctactataca
atggctcacttcagtagatttatcaaacctgatgcagtaaggatagaggcaacacaccca
gatgaagagttaatgcttacagcagtagaaaatccagatggttcttttgtgatggcggta
tttaacccttccgaagagaaaaaaaatatagaaatatctgtaccaaaacaaaatgtctat
tctcagatagatgcaaaagcaatacaaaccattattattcataaaaattaa

DBGET integrated database retrieval system