KEGG   Riemerella anatipestifer RA-CH-1: B739_0110Help
Entry
B739_0110         CDS       T02331                                 

Definition
(GenBank) Pyruvate/2-oxoglutarate dehydrogenase complex, dihydrolipoamide acyltransferase (E2) component,-related enzyme
  KO
K00627  pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
rag  Riemerella anatipestifer RA-CH-1
Pathway
rag00010  Glycolysis / Gluconeogenesis
rag00020  Citrate cycle (TCA cycle)
rag00620  Pyruvate metabolism
rag01100  Metabolic pathways
rag01110  Biosynthesis of secondary metabolites
rag01120  Microbial metabolism in diverse environments
rag01130  Biosynthesis of antibiotics
rag01200  Carbon metabolism
Module
rag_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:rag00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    B739_0110
   00020 Citrate cycle (TCA cycle)
    B739_0110
   00620 Pyruvate metabolism
    B739_0110
Enzymes [BR:rag01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     B739_0110
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding Biotin_lipoyl_2 GCV_H DUF2118 PYNP_C
Motif
Other DBs
NCBI-ProteinID: AFR34718
UniProt: J9R3R5
Position
121297..122895
Genome map
AA seq 532 aa AA seqDB search
MAEIITMPRLSDTMTEGKVSKWHKQVGDAVKEGDILAEIETDKAVQDFESEVNGTLLYVG
VSEGNAAPVDTILAIIGKEGEDISGLVGGNQSTPQPASSENTSVENTVTEATSSVEIPKG
VEVINMPRLSDTMTEGKVAKWNKNVGDAVKEGDILAEIETDKAVQDFESEFNGTLLYQGV
GEGEAAEVDKILAIIGPAGTDVSAIVSNGGVVSKPQAQQEQSSIASSAKAENVSTSNASV
STDRVAISPLARKMAEEKGIDITNLKGSGENGRIVKKDIENYQPNATEQRSASVTPAAQV
AMNFVAGETTETPNSQVRNVIAKRLSESKFSAPHYYLMVEVNMDKAITARKEINSLPDTK
VSFNDMVIKATAMALRKHPQINSSWAGDKIIHHGSINIGVAVAIPDGLVVPVLKNADFMN
YSQISAGVKDMASRAKSKGLKANEMEGSTFSISNLGMFGIETFTSIINQPNSCILSVGAI
IEKPVVKDGQIVVGNTMKLSLACDHRVVDGATGAEFLQTLKTYLENPFALLV
NT seq 1599 nt NT seq  +upstreamnt  +downstreamnt
atggcagaaataattacaatgcctcgcctttctgatacgatgacagaaggtaaggtttcc
aaatggcataagcaggttggagatgctgtaaaggaaggagatattcttgcagaaatagaa
acggataaagccgttcaagattttgaatcagaggttaacggaacactactttatgtaggt
gtaagtgaaggaaatgcagctcctgtggatactattttggcaattatagggaaagaaggc
gaagatatttcagggcttgtgggcggtaatcaaagtacacctcaaccagcttcatcagaa
aatacttctgtagaaaatacagtaacagaagctacgtcgtcagtagagatacctaaaggt
gttgaggtaattaatatgcctcgtctgtctgatacaatgacagaaggtaaagtagctaaa
tggaataaaaatgtaggagacgccgtaaaagaaggagatattttagctgaaattgaaaca
gataaagccgttcaagattttgaatcagaatttaacggaactcttttataccaaggtgta
ggagaaggagaagcagctgaagtagataaaatattagccattataggacctgctggaaca
gatgtttctgctattgtttctaatggcggagtggttagtaagcctcaagctcaacaagaa
cagtcaagtatagcatctagtgcaaaagcagaaaatgtttcaacatctaatgctagtgtt
tcaacagatagagtggctatttctccattggctagaaaaatggcagaggagaagggtata
gatattacaaatctaaaaggttctggagagaacggaagaatagtaaagaaagatatagaa
aactatcagccaaacgcaacagaacagcgttctgcttctgtaacgccagctgcacaagta
gctatgaattttgttgctggagaaactacagaaacacctaactctcaagttagaaatgta
atcgcaaaaagactttctgaaagtaagttttcagcacctcattactatttaatggtagag
gtgaatatggataaagccatcactgctagaaaggaaattaactcacttcctgacactaaa
gtatcgtttaacgatatggtgattaaggcgacagctatggctcttagaaagcaccctcaa
atcaatagtagctgggcgggagataagattattcatcatggtagcatcaatattggcgtg
gcagtggctatcccagacggattagtagtacctgtattgaagaatgcagactttatgaat
tatagtcaaatttctgcaggagttaaagatatggcttctagagcaaaatctaaaggtctc
aaagctaacgaaatggaaggttctacattctcaatatctaatcttggaatgtttggaata
gaaacatttacttctattatcaatcaaccgaactcttgtatactttcagtaggtgctatt
atagagaagcctgtggttaaagacggacaaattgtagtgggcaatactatgaagttgtct
ttagcatgtgaccaccgtgtggtagatggtgctactggtgcagagtttttacagacatta
aagacttatctagaaaatccgtttgcattattggtttaa

DBGET integrated database retrieval system