KEGG   Riemerella anatipestifer RA-CH-1: B739_0110Help
Entry
B739_0110         CDS       T02331                                 

Definition
Pyruvate/2-oxoglutarate dehydrogenase complex, dihydrolipoamide acyltransferase (E2) component,-related enzyme
Orthology
K00627  
pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
rag  Riemerella anatipestifer RA-CH-1
Pathway
Glycolysis / Gluconeogenesis
Citrate cycle (TCA cycle)
Pyruvate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:rag00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    B739_0110
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    B739_0110
   00020 Citrate cycle (TCA cycle)
    B739_0110
   00620 Pyruvate metabolism
    B739_0110
Enzymes [BR:rag01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     B739_0110
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
121297..122895
Genome map
AA seq 532 aa AA seqDB search
MAEIITMPRLSDTMTEGKVSKWHKQVGDAVKEGDILAEIETDKAVQDFESEVNGTLLYVG
VSEGNAAPVDTILAIIGKEGEDISGLVGGNQSTPQPASSENTSVENTVTEATSSVEIPKG
VEVINMPRLSDTMTEGKVAKWNKNVGDAVKEGDILAEIETDKAVQDFESEFNGTLLYQGV
GEGEAAEVDKILAIIGPAGTDVSAIVSNGGVVSKPQAQQEQSSIASSAKAENVSTSNASV
STDRVAISPLARKMAEEKGIDITNLKGSGENGRIVKKDIENYQPNATEQRSASVTPAAQV
AMNFVAGETTETPNSQVRNVIAKRLSESKFSAPHYYLMVEVNMDKAITARKEINSLPDTK
VSFNDMVIKATAMALRKHPQINSSWAGDKIIHHGSINIGVAVAIPDGLVVPVLKNADFMN
YSQISAGVKDMASRAKSKGLKANEMEGSTFSISNLGMFGIETFTSIINQPNSCILSVGAI
IEKPVVKDGQIVVGNTMKLSLACDHRVVDGATGAEFLQTLKTYLENPFALLV
NT seq 1599 nt NT seq  +upstreamnt  +downstreamnt
atggcagaaataattacaatgcctcgcctttctgatacgatgacagaaggtaaggtttcc
aaatggcataagcaggttggagatgctgtaaaggaaggagatattcttgcagaaatagaa
acggataaagccgttcaagattttgaatcagaggttaacggaacactactttatgtaggt
gtaagtgaaggaaatgcagctcctgtggatactattttggcaattatagggaaagaaggc
gaagatatttcagggcttgtgggcggtaatcaaagtacacctcaaccagcttcatcagaa
aatacttctgtagaaaatacagtaacagaagctacgtcgtcagtagagatacctaaaggt
gttgaggtaattaatatgcctcgtctgtctgatacaatgacagaaggtaaagtagctaaa
tggaataaaaatgtaggagacgccgtaaaagaaggagatattttagctgaaattgaaaca
gataaagccgttcaagattttgaatcagaatttaacggaactcttttataccaaggtgta
ggagaaggagaagcagctgaagtagataaaatattagccattataggacctgctggaaca
gatgtttctgctattgtttctaatggcggagtggttagtaagcctcaagctcaacaagaa
cagtcaagtatagcatctagtgcaaaagcagaaaatgtttcaacatctaatgctagtgtt
tcaacagatagagtggctatttctccattggctagaaaaatggcagaggagaagggtata
gatattacaaatctaaaaggttctggagagaacggaagaatagtaaagaaagatatagaa
aactatcagccaaacgcaacagaacagcgttctgcttctgtaacgccagctgcacaagta
gctatgaattttgttgctggagaaactacagaaacacctaactctcaagttagaaatgta
atcgcaaaaagactttctgaaagtaagttttcagcacctcattactatttaatggtagag
gtgaatatggataaagccatcactgctagaaaggaaattaactcacttcctgacactaaa
gtatcgtttaacgatatggtgattaaggcgacagctatggctcttagaaagcaccctcaa
atcaatagtagctgggcgggagataagattattcatcatggtagcatcaatattggcgtg
gcagtggctatcccagacggattagtagtacctgtattgaagaatgcagactttatgaat
tatagtcaaatttctgcaggagttaaagatatggcttctagagcaaaatctaaaggtctc
aaagctaacgaaatggaaggttctacattctcaatatctaatcttggaatgtttggaata
gaaacatttacttctattatcaatcaaccgaactcttgtatactttcagtaggtgctatt
atagagaagcctgtggttaaagacggacaaattgtagtgggcaatactatgaagttgtct
ttagcatgtgaccaccgtgtggtagatggtgctactggtgcagagtttttacagacatta
aagacttatctagaaaatccgtttgcattattggtttaa

DBGET integrated database retrieval system