KEGG   Riemerella anatipestifer RA-CH-1: B739_0160Help
Entry
B739_0160         CDS       T02331                                 

Definition
hypothetical protein
Orthology
K01480  
agmatinase [EC:3.5.3.11]
Organism
rag  Riemerella anatipestifer RA-CH-1
Pathway
Arginine and proline metabolism
Metabolic pathways
Class
Metabolism; Amino acid metabolism; Arginine and proline metabolism [PATH:rag00330]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(171581..172438)
Genome map
AA seq 285 aa AA seqDB search
MKTYAGIPEENANLENSKVMLVTVPYDGTSTWGKGADKGPELFLDASENMELYDIETGTE
PYLEGVYLAGEVTEDSSPEAMTEAVYQKTKELLKHEDKLFTLFGGEHSVSIGSIRAVGEK
YENLTVLQLDAHTDLRPEFHGSTSNHACAVFEASQKHNLVQVGIRSMDAEEMQYVPKGQC
FWAHEIAQNPNWIDEVLEKVSGNVYITIDLDAFDPSIAPSTGTPEPGGLAWYPTLELLKK
VFEKCNVVAFDIVELMDSPMAKPTAFLAAKLYYKMLAYYHLANKK
NT seq 858 nt NT seq  +upstreamnt  +downstreamnt
atgaaaacatacgcaggtattccagaggaaaatgcaaatttagaaaactcgaaagtaatg
ttagttaccgttccttatgacgggacatctacttggggtaaaggagccgataaaggtcca
gaactatttttagatgcttccgaaaatatggaactttacgatattgaaacaggtacagaa
ccttatttagaaggtgtatatttagcaggtgaggtaacggaagatagctctccagaagct
atgacggaagcggtttaccaaaaaacaaaagaactcctaaaacacgaagataaattattt
actctctttggtggggaacattcggtatctattggctctatccgtgcggtaggagagaag
tatgagaaccttacggtattacaattagatgctcatacagaccttcgtccagagtttcac
ggttctacatctaaccacgcttgtgcggtgtttgaagctagtcagaagcacaatctagtg
caagtgggtatccgctctatggatgcagaagagatgcaatatgtaccaaaaggacagtgt
ttttgggctcacgagattgcccaaaatcctaattggatagatgaggtattagaaaaggtg
tcaggaaatgtttacatcacgatagatttagatgcatttgacccttctattgctccatct
acagggacgccagaacctggaggtttagcttggtatcctactttagagcttctaaaaaag
gtatttgaaaaatgcaatgtagtggcttttgatatagtagaactaatggactctccaatg
gcgaaacctacggcatttttagcagcaaagctatattataagatgttagcttattatcat
ttggctaacaagaaataa

DBGET integrated database retrieval system