KEGG   Riemerella anatipestifer RA-CH-1: B739_0187Help
Entry
B739_0187         CDS       T02331                                 

Definition
hypothetical protein
Orthology
K00376  
nitrous-oxide reductase [EC:1.7.2.4]
Organism
rag  Riemerella anatipestifer RA-CH-1
Pathway
Nitrogen metabolism
Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:rag00001]
 Metabolism
  Energy metabolism
   00910 Nitrogen metabolism
    B739_0187
Enzymes [BR:rag01000]
 1. Oxidoreductases
  1.7  Acting on other nitrogenous compounds as donors
   1.7.2  With a cytochrome as acceptor
    1.7.2.4  nitrous-oxide reductase
     B739_0187
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
197655..199661
Genome map
AA seq 668 aa AA seqDB search
MKINKILGYSALFLGSTYALESCKPKGTENAVAGDAAEKVYVAPGKHDEFYNFVSGGFNG
QMGVYGLPSGRLLKVVPIFSVNPENGYGYSEETKPMLETSHGFIPWDDQHHLELSQTNGE
VDGRWIFANANNTPRIARVDLSSFKTVEVLELPNSAGNHSSPFITENTEYVVAGTRFSVP
TDDVNGDVPINSFKENFKGVISFVKVDKTTGEMNLAFQIEAPGVNFDLSHAGKGKSHGWF
FFSCYNSEQANTLLEVNASQFDKDFIMALDWKKAEEYVKSGKGRKVKTQYAHNKWNEETH
TGSSKMEQEVTILSTKELKDLCYFMPTPKSPHGCDVDPTGEYIVGSGKLAALIPVHSFSK
MLNAIKNKEFAGEYDGIPILKYESTLHGEVQKPGLGPLHTEFDDKGNAYTSFFVSSEVVK
WDIKTLKVLDRQPTFYSVGHLMIPGGDSKKPFGKYLVAYNKITKDRFLPTGPELAQSAQL
YDISGDKMKLLLDFPTFGEPHYAQAIPAKLIVDKQVKFYDIAKNKHPYVTKGEGESRVVR
EGNKVHVYMTSIRSHFAPDNIEGIKVGDEVYFHVTNLEQDWDVPHGFAIKGAENAELLIM
PGETCTFKWIPKKAGMFPMYCTDFCSALHQEMQGYVRVSPTGSSTPLLFSLNNKADNAQG
PVKKAETK
NT seq 2007 nt NT seq  +upstreamnt  +downstreamnt
atgaaaataaataagatattaggatattcagcactatttctagggagcacctatgcctta
gaaagttgtaagcctaaaggaacagaaaatgctgtggctggagatgcggcagagaaagtc
tatgtagcccctggtaaacacgacgaattctataactttgtgagtggaggatttaacggt
caaatgggagtatatggtttacctagtggaagattactaaaggtggtacctatattctcc
gtaaaccccgaaaatggctatggttatagtgaagaaactaaacctatgttagaaacatcc
catggttttatcccatgggacgaccagcatcacctagaactttcacaaaccaatggagaa
gttgatggacgctggatttttgctaacgctaataacacgcctcgcatcgcacgagttgac
ctttctagctttaaaacagtagaagttttagaattaccaaactcggcagggaatcactcg
tctccttttattacagagaacacagagtatgtagtagcaggaacgcgtttttccgttcct
acagatgatgttaatggtgatgtacctatcaacagttttaaagaaaattttaaaggcgta
atttcctttgtaaaagtagataagacaacaggagaaatgaatttagcctttcaaatagaa
gctcctggagttaattttgacttatctcacgcaggtaaaggcaaatctcatggttggttt
ttcttctcttgttataattcagaacaagctaataccttgttagaagttaatgcttctcag
tttgacaaagattttattatggctttagactggaaaaaagcagaagaatatgtaaagtct
ggcaaaggaagaaaggttaaaacccaatatgcacacaacaaatggaatgaagaaacccac
acaggaagttctaaaatggagcaagaagtaacgatactctctacaaaagagcttaaagac
ttgtgctattttatgccaacacctaaatcgccacacggatgcgatgtagatcctacaggt
gagtatattgtaggttctggcaaattagcagctctgattcctgtacatagtttcagtaaa
atgctgaacgctattaaaaacaaagagtttgctggagaatacgacggcattcctattctg
aaatatgaatctaccctacacggagaggttcagaaacctggcttaggccctcttcataca
gaatttgatgataaaggtaatgcctatacttcattctttgtttcttcggaggttgtaaaa
tgggatattaaaactctcaaagttttagatcgtcagcctacattctattctgtggggcat
ttaatgattccaggtggagactctaagaaacctttcggtaagtacttggtagcttataac
aaaattaccaaagatagatttttacctacaggtccagagctagctcagtccgcacagtta
tacgacattagtggagataaaatgaagctacttcttgatttccctacttttggagagcct
cactacgcccaagctattcccgcaaaactcatcgtagataagcaagtaaagttttatgat
atagctaaaaacaaacacccttatgtaaccaaaggcgaaggagagtctagagtggtaaga
gaaggcaacaaagttcatgtctatatgacctctatccgttctcatttcgcacctgataat
attgaaggaattaaagttggtgatgaagtttattttcatgtaaccaatctagagcaagac
tgggatgtaccacatggctttgccattaaaggtgcagaaaatgcagagctcctcattatg
cctggagaaacttgcacattcaagtggattcctaaaaaagcaggaatgttccctatgtat
tgtacagacttctgctctgctctacaccaagagatgcaaggctatgtaagagtgtcgcca
acagggagctcaacacctctactgtttagccttaacaataaggcagacaacgcccaaggc
cctgtaaaaaaagctgaaactaaataa

DBGET integrated database retrieval system