KEGG   Riemerella anatipestifer RA-CH-1: B739_0301Help
Entry
B739_0301         CDS       T02331                                 

Definition
succinyl-CoA synthetase subunit beta
Orthology
K01903  
succinyl-CoA synthetase beta subunit [EC:6.2.1.5]
Organism
rag  Riemerella anatipestifer RA-CH-1
Pathway
Citrate cycle (TCA cycle)
Propanoate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Citrate cycle (TCA cycle, Krebs cycle)
Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:rag00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    B739_0301
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    B739_0301
   00640 Propanoate metabolism
    B739_0301
   00660 C5-Branched dibasic acid metabolism
    B739_0301
Enzymes [BR:rag01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.5  succinate---CoA ligase (ADP-forming)
     B739_0301
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(317269..318459)
Genome map
AA seq 396 aa AA seqDB search
MNLHEYQSKEILAKYGVRVQRGIVASTVEEAKKAAEQLSAETGTKAWVVKAQVHAGGRGK
GGGVKFSPNMEKLEENARNIIGMQLVTPQTSAEGKKVHSVLIAEDMYYPGDSEPKEYYVS
VLLDRAKGKNMIVYSTEGGMDIEQVAEETPHLIHNEEVDPALGLQPFQARKIAFNLGLEG
EAFKDFVKFITALYNAYVGIDASLFEINPVLKTSDNKIAAVDAKVTLDNNALFRHKDLAE
LRDKREEDPTEVEAGEAGLNFVKLDGNVGCMVNGAGLAMATMDIIKLSGGNPANFLDVGG
TADAERVEKAFGIILKDPNVKAILINIFGGIVRCDRVAQGVVDAYKSFGELPVPLIVRLQ
GTNAEEAKRLIDESGLPVHSAITLEEAANKVKEVLA
NT seq 1191 nt NT seq  +upstreamnt  +downstreamnt
atgaatcttcacgagtatcaatcaaaagagattttagcgaaatacggcgttagagtacaa
agaggtatagtagctagcaccgtagaggaagcaaaaaaagcagcagaacagctttctgca
gaaacaggaactaaagcgtgggtagtaaaagctcaggtacacgcaggtggtagaggtaaa
ggtggaggtgttaagttctctcctaatatggaaaagttagaagaaaacgcaagaaacatc
atcggaatgcagttagtaacgcctcaaacttctgctgaaggtaaaaaagtacactctgta
cttatcgcagaagatatgtattatcctggagattctgaaccaaaagaatactatgtttct
gtacttttagatagagctaaaggaaagaatatgattgtatattctacagaaggtggtatg
gatatagagcaagtggcagaagaaactccgcatcttattcataacgaagaggtagatcct
gctttaggattacaaccttttcaagctagaaagattgcatttaatctaggtctagaagga
gaagctttcaaggattttgtaaaattcattacagctctttacaatgcttatgtgggaatt
gatgcttctttatttgaaatcaacccagttcttaaaacttcagataataaaatcgctgca
gtagatgctaaagtaactttagataataatgctcttttccgtcataaagatttggctgaa
ttaagagataaaagagaggaagaccctacagaagttgaagctggtgaggctggattaaac
ttcgttaagctagatggtaatgtaggttgtatggtaaacggtgctggtttggcaatggct
actatggatatcattaaactttctggaggtaaccctgctaacttcctagatgtaggtggt
actgcagatgctgaaagagtagaaaaggcatttggtattatccttaaagaccctaatgta
aaagcaattcttatcaatatctttggtggtattgtaagatgtgatagagtggcacaaggt
gtagtagatgcttacaagagcttcggagaacttcctgtacctcttatcgtaagattacaa
ggaactaatgctgaagaagctaagagattaatcgacgaatctggattaccagtacattct
gcaattactctagaagaagcagcaaacaaagtaaaagaggtattagcttaa

DBGET integrated database retrieval system