KEGG   Riemerella anatipestifer RA-CH-1: B739_0320Help
Entry
B739_0320         CDS       T02331                                 

Definition
(GenBank) hypothetical protein
  KO
K00845  glucokinase [EC:2.7.1.2]
Organism
rag  Riemerella anatipestifer RA-CH-1
Pathway
rag00010  Glycolysis / Gluconeogenesis
rag00052  Galactose metabolism
rag00500  Starch and sucrose metabolism
rag00520  Amino sugar and nucleotide sugar metabolism
rag00521  Streptomycin biosynthesis
rag01100  Metabolic pathways
rag01110  Biosynthesis of secondary metabolites
rag01120  Microbial metabolism in diverse environments
rag01130  Biosynthesis of antibiotics
rag01200  Carbon metabolism
Module
rag_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:rag00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    B739_0320
   00052 Galactose metabolism
    B739_0320
   00500 Starch and sucrose metabolism
    B739_0320
   00520 Amino sugar and nucleotide sugar metabolism
    B739_0320
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    B739_0320
   00524 Neomycin, kanamycin and gentamicin biosynthesis
    B739_0320
Enzymes [BR:rag01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     B739_0320
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glucokinase
Motif
Other DBs
NCBI-ProteinID: AFR34926
UniProt: J9QSR2
Position
346188..347237
Genome map
AA seq 349 aa AA seqDB search
MPFQNKFPLHLPGEKSTENQNISLVAADVKQKDTTLGYYVSENGKLELKAKKEYNTQDFG
LFSDILNLFLEEHSLSKPSRISIAVPGPVLNGKCTTENLPFDLDIELIRSRTEVEHITLI
NDLEAMAYGLKGTEDKDFCTLHKNSSTTKGNVAILAPGRGLGEAGMFWDGECLRPFATEG
GHSEFSPRAEDELELYRFLKAIHGIVSWESVLSHEGLFNVYRFVRDMRRQEEPEWLTQKL
EKGDCHKVIIDAALSGENRACALTVEAYVDFIAREASNLVLKLKATGGLILAGSLAVKIE
ALLKMPSFYQTFVISDKMENILKSTPIYLLKNENAILTGAAYYGAFGKH
NT seq 1050 nt NT seq  +upstreamnt  +downstreamnt
atgccttttcaaaataaatttccactccatttacctggagaaaaatcaactgaaaaccaa
aacataagcctcgttgctgctgatgtaaaacagaaggacactaccctaggctactatgtt
tctgagaacggaaaattagaattaaaagcaaaaaaagaatacaacacccaagattttggg
ctttttagtgacattctaaaccttttcttagaagagcatagcttaagcaaaccctctaga
atttctatagcagtaccaggacctgttttaaatggcaaatgcactaccgaaaaccttcct
tttgatttagatatagaactcattagaagcagaaccgaggtagaacacattacccttatc
aacgacttagaagcaatggcctatggacttaaaggcacggaagataaagacttctgcacc
ctacacaaaaacagcagcactactaaaggcaatgtagctattttagctccagggagaggt
ttaggcgaagcaggaatgttttgggacggagaatgtttacgcccttttgcaaccgaaggt
gggcactccgaattttctcctagagcagaagacgagctagaactttaccgttttttaaaa
gcaatacacggcatcgtaagttgggagtcggtgttatctcatgagggattatttaatgtg
tatcgttttgtgagagatatgaggcgccaagaagaaccagaatggcttacacaaaaacta
gagaaaggagattgccacaaggtcatcatagatgcggcacttagcggcgaaaacagagct
tgtgctttaaccgtagaggcgtatgttgatttcattgctagagaagcgagtaacctagtc
ctaaaactaaaagcaacaggagggcttattttagcaggaagccttgcagtaaagatagag
gcactactcaaaatgccaagtttctaccaaacttttgtgattagcgacaaaatggaaaac
atcttaaagagtacccctatctatcttctaaagaatgagaatgccattcttacaggagcg
gcttactacggtgcttttggaaaacactag

DBGET integrated database retrieval system