KEGG   Riemerella anatipestifer RA-CH-1: B739_0438Help
Entry
B739_0438         CDS       T02331                                 

Definition
GTP cyclohydrolase
Orthology
K01495  
GTP cyclohydrolase I [EC:3.5.4.16]
Organism
rag  Riemerella anatipestifer RA-CH-1
Pathway
Folate biosynthesis
Metabolic pathways
Module
Tetrahydrofolate biosynthesis, GTP => THF
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:rag00790]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
470207..470872
Genome map
AA seq 221 aa AA seqDB search
MNNHFDNDDDVFTGKEHTPLRADAFEKTPEEKIAIIEKHFAEIMQTLGLDMTDDSLKDSP
KRVAKMYVNEIFGGLLPENKPGISTFSNKYKYRQMLVEKDITVYSFCEHHFLPIIGRAHV
AYISNGEVIGLSKINRIVDYYAKRPQVQERLTMQIVDALKEALGTNDVACIIDAKHLCVN
CRGIKDTASSTITAELSGIFRTNPITRQEFLHYVGSHTKLD
NT seq 666 nt NT seq  +upstreamnt  +downstreamnt
atgaataaccattttgataatgatgacgatgtgtttacaggcaaagagcacacaccctta
agagctgatgcctttgagaagacacctgaagaaaaaattgccattatagagaaacatttt
gccgaaattatgcaaactttagggctagatatgacagatgactccctaaaagattcgcct
aagcgagtagccaaaatgtatgtaaatgagatttttggcggattacttccagaaaataag
ccaggtatctctacttttagcaacaagtataaataccgacaaatgctcgtggaaaaagac
attacagtttattctttttgtgagcatcattttctgcctataatcggtagagctcatgtg
gcttatatctctaacggagaagtgattgggttatccaaaatcaatagaattgtagattac
tacgccaaacgcccacaagtacaagaaaggctcaccatgcagatagtagatgcattaaaa
gaagctctcggtactaatgatgtggcttgtattattgatgctaagcacctttgcgttaat
tgcagaggcatcaaggatacggctagctctaccattacagccgagcttagtggtatcttt
agaactaatcctatcactaggcaagagtttctacattatgttggtagtcacacaaaacta
gattaa

DBGET integrated database retrieval system