KEGG   Riemerella anatipestifer RA-CH-1: B739_1043Help
Entry
B739_1043         CDS       T02331                                 

Definition
hypothetical protein
Orthology
K03550  
holliday junction DNA helicase RuvA [EC:3.6.4.12]
Organism
rag  Riemerella anatipestifer RA-CH-1
Pathway
Homologous recombination
Class
Genetic Information Processing; Replication and repair; Homologous recombination [PATH:rag03440]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1112314..1112898)
Genome map
AA seq 194 aa AA seqDB search
MIYSLRGIVQELSPTHLIIETGGVGYFVSVSVNTSKHFSIGKESLIYTQQIIREDAHLLY
GFSELKEKEMFNLLISVNGVGPASAMIMLSSLELREIAQAILSSNSAVLQKVKGIGTKTA
QRIIIDLKDKVLHFGADESDISTVIDNKVKEESLSALEVLGIPKKMSEKLADKILKQNPE
IQTEDLVKQILKNI
NT seq 585 nt NT seq  +upstreamnt  +downstreamnt
atgatttactctctacgaggtatcgttcaggagcttagcccaacccatttaattatagaa
actggtggtgtaggctactttgtaagcgttagtgtaaacacttctaaacacttttccatt
gggaaagaatctttaatctacacacaacaaatcattcgagaagacgctcacttattgtac
ggtttttcggagctcaaagagaaagaaatgtttaacctacttatttctgtaaatggtgta
ggaccagcctctgctatgattatgctttcctcactagaattaagagaaatagcacaagcc
atactctctagcaatagtgctgtattacaaaaagtaaaaggtataggcaccaaaactgca
caacgaattatcattgatttaaaagataaagtattgcattttggagcagatgaatctgat
atttccaccgttattgataataaagtaaaagaagaatcgttatctgcattagaagtttta
ggaattcctaaaaaaatgtcagaaaaattagcagacaaaattttgaaacaaaatccagaa
attcaaacggaagatttagtaaaacaaattttgaaaaatatttaa

DBGET integrated database retrieval system