KEGG   Riemerella anatipestifer RA-CH-1: B739_1138Help
Entry
B739_1138         CDS       T02331                                 

Definition
dTDP-4-dehydrorhamnose 3,5-epimerase-related enzyme
Orthology
K01790  
dTDP-4-dehydrorhamnose 3,5-epimerase [EC:5.1.3.13]
Organism
rag  Riemerella anatipestifer RA-CH-1
Pathway
Streptomycin biosynthesis
Polyketide sugar unit biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Metabolism of terpenoids and polyketides; Polyketide sugar unit biosynthesis [PATH:rag00523]
Metabolism; Biosynthesis of other secondary metabolites; Streptomycin biosynthesis [PATH:rag00521]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1227262..1227807
Genome map
AA seq 181 aa AA seqDB search
MKIKETPLKDCYIIEPTIFEDERGYFYEKFNEKKFEDLTGMNGHFVQDNISKSSYGVLRG
LHLQKGEHAQAKLVSCLEGKVWDVAVDLREDSPSFGKWYGVELTAENKLQFYVPRGFAHG
FAVLSEMAVFAYKCDNFYNKESEGGILWNDADLAIDWKLDETDVILSEKDKVQLPFSKKN
F
NT seq 546 nt NT seq  +upstreamnt  +downstreamnt
atgaagattaaagaaacgccactaaaggattgttacatcatagagcctactatttttgaa
gacgaaagaggttacttttacgagaagtttaacgagaaaaaatttgaggaccttacggga
atgaatgggcattttgttcaagataatatttctaaatcgtcttatggggttcttagaggg
ttgcacctacagaaaggagagcatgcccaagcgaaactcgtatcttgcttagaggggaag
gtttgggatgtggcggtggatttaagagaagattcgccttcgtttgggaaatggtatgga
gtggaattaacggcagaaaataagttacagttttatgtgccgagaggctttgctcacggc
tttgcggtgttgagtgaaatggcagtttttgcctataaatgtgataatttttacaataag
gagtctgaaggcggaatcctttggaacgatgcggatttagctatagattggaagttggat
gagacagatgttattctttccgaaaaagataaagtacagttgccattttctaaaaagaat
ttttaa

DBGET integrated database retrieval system