KEGG   Riemerella anatipestifer RA-CH-1: B739_1142Help
Entry
B739_1142         CDS       T02331                                 

Definition
Dihydrofolate reductase
Orthology
K00287  
dihydrofolate reductase [EC:1.5.1.3]
Organism
rag  Riemerella anatipestifer RA-CH-1
Pathway
One carbon pool by folate
Folate biosynthesis
Metabolic pathways
Module
Tetrahydrofolate biosynthesis, GTP => THF
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:rag00790]
Metabolism; Metabolism of cofactors and vitamins; One carbon pool by folate [PATH:rag00670]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1231183..1231653)
Genome map
AA seq 156 aa AA seqDB search
MGKNNEIGANNQLLWHLPKDLKHFKNLTSGHPIIMGRKTYESIGRPLPNRTNIVVSQKKD
WFEEGILIVGTLKEAIKFAKKINENIFILGGGSIYEQTIDQVDRLEVTLVDTTLEADTFF
PKINPKEWLKTDEICHEKDEQNPYDFCFQTYERVQK
NT seq 471 nt NT seq  +upstreamnt  +downstreamnt
atgggtaaaaataacgaaataggagctaataatcagcttctttggcatttacctaaagat
ttaaaacactttaaaaatttaacctcaggacaccccataattatggggcggaaaacctac
gagagcattggaagacctcttcccaacagaaccaacattgtggttagtcaaaaaaaagat
tggtttgaagaaggcattttgattgttggtactttaaaggaggccattaaatttgccaag
aaaataaacgaaaacattttcatccttggtggtggtagcatttatgagcagaccatagac
caagttgaccgactggaagtaactttagtagatactactctagaagcagatacctttttc
ccaaaaatcaacccaaaagaatggctaaaaactgatgaaatttgccacgaaaaagacgag
caaaatccttatgatttctgctttcagacctatgaaagagtacaaaaataa

DBGET integrated database retrieval system