KEGG   Riemerella anatipestifer RA-CH-1: B739_1173Help
Entry
B739_1173         CDS       T02331                                 

Definition
hypothetical protein
Orthology
K00428  
cytochrome c peroxidase [EC:1.11.1.5]
Organism
rag  Riemerella anatipestifer RA-CH-1
Brite
Enzymes [BR:rag01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.5  cytochrome-c peroxidase
     B739_1173
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1262371..1263417
Genome map
AA seq 348 aa AA seqDB search
MKSYIITGLVVLVSVLSCRNDEAEVQYPIDQPYTFGIPSNFPEVKYNLQANKPTEYGVQL
GKKLFYDGRLAKDNAVACAFCHIQEDAFTHHGHTVSHGVEGREGFRNALPIQNMIFLDKY
MWDGSVTDLEMQPIIPISAHEEMDETIENITQKIKDDKDYKRLFTIVYGDDKVTAERILK
SLTQFMSIMISANSKYDKVVRNEGEKFTEEEARGYTIFKQKCTACHSTDLFTDQSYRNTG
LPYNPILKDEGRKRVTGKDSDFLKFRVPSLRNVEYTAPYTHDGRFYTLKALLDFYDSGVI
DNPNLDPEFRKVKGRVGIPLTEQEKYDLISFLKTLSDTQFITNPAFSE
NT seq 1047 nt NT seq  +upstreamnt  +downstreamnt
atgaaaagctacattatcacagggctggtagttcttgtttctgtactttcttgtcggaat
gatgaggcggaagttcagtatcctatagaccaaccttacacatttggaataccatctaat
tttccagaagtgaagtataatttacaggctaataaacctacggaatatggcgttcagtta
gggaaaaagctattttatgacggaagattagccaaagataatgctgtggcgtgtgctttt
tgccatattcaagaagatgcctttacacatcatgggcatacggtaagccacggagtagaa
ggtagagagggttttaggaacgctttgccaattcaaaatatgatttttttggataaatat
atgtgggacggttctgtaaccgatttagagatgcaacccattattcctatttcggcacac
gaagaaatggacgaaaccatagaaaatattacacaaaagattaaagacgataaagattat
aaaagactttttaccattgtgtatggcgatgacaaagttacggctgaaagaattttgaaa
tctctcacacagtttatgtctataatgatttcggctaacagtaagtacgataaagtggta
aggaatgaaggagaaaaatttacagaggaggaggcgagaggttatactatttttaagcaa
aaatgtacggcatgtcattccacggatttgtttacagaccaaagctacagaaatacaggg
ctgccttataatccgatattaaaagatgaaggtagaaaaagagtaacaggtaaagattct
gattttttgaagtttagagtgcctagccttagaaatgtggaatataccgctccttatact
cacgatggtagattttataccttaaaggcattgcttgatttttatgattcaggagttata
gacaatcctaacttagaccctgaatttagaaaggttaaaggtagagtaggaattccttta
acggagcaagaaaaatatgaccttatttcatttttaaaaacattaagtgatactcaattt
attactaacccagcattttcagaatag

DBGET integrated database retrieval system