KEGG   Riemerella anatipestifer RA-CH-1: B739_1188Help
Entry
B739_1188         CDS       T02331                                 

Definition
hypothetical protein
Orthology
K00852  
ribokinase [EC:2.7.1.15]
Organism
rag  Riemerella anatipestifer RA-CH-1
Pathway
Pentose phosphate pathway
Brite
KEGG Orthology (KO) [BR:rag00001]
 Metabolism
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    B739_1188
Enzymes [BR:rag01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.15  ribokinase
     B739_1188
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1279161..1280054)
Genome map
AA seq 297 aa AA seqDB search
MKLSKEQPRILVVGSSSVDLVLKTEHYPELGETVMANSSENFFGGKGANQAVGTARLGAS
VYFVGCVGMDPYGQQILRNLVEENVNVGFVVENPDIETGTAYVTTSKGKNAIVVVPSANY
ALSPKHLENPKHLFETADLVLVQLEITDTVIEKVLELCKKNGTKLGIYAAPARPLSKELI
EYASFIVAKSNDLSTLFGDDHRDAVLQKLPNKLFVRDDTNSTIYYNGSEMKYFRNDPEEA
AYRMGMGDAFTSGFAVALCHGNPINECVKFGNDVSLKVSQHRGSQKGLPYLKDFNLA
NT seq 894 nt NT seq  +upstreamnt  +downstreamnt
atgaaacttagtaaagaacaacctagaatccttgtagtaggaagctcatctgtggatttg
gttttaaaaacagaacactatcctgagctgggagaaacagtgatggctaactcctccgaa
aatttcttcggtggaaaaggggctaatcaagccgtgggaactgcaagactaggagctagt
gtttactttgtaggatgtgtaggtatggatccttatgggcaacaaatattaagaaatctt
gtagaagaaaatgtaaatgtaggatttgttgtagaaaaccctgatatagaaactggtacg
gcatatgttaccacttctaaaggtaaaaatgccattgttgtagtcccatcagctaactat
gccttgagtcctaaacatctagaaaatcccaaacacctgtttgaaaccgctgatttagtt
ttggttcaactagaaatcacggatacggttatagaaaaagtattagagctttgcaaaaaa
aacggcactaaacttggcatatatgcggctcccgcaagaccactttccaaagaactaata
gaatatgctagttttatagtcgccaaaagcaacgatttatctacactttttggagatgac
cacagagatgcggttttacaaaaattgcctaataaactttttgtaagagatgataccaat
tctaccatatattacaacggttctgaaatgaaatatttccgtaacgacccagaagaagcg
gcttacagaatgggaatgggtgatgcctttacttcaggatttgctgttgctctatgtcac
ggaaatcccatcaacgaatgtgtaaaatttggcaacgatgtttcactgaaagtatctcaa
catagaggttcgcaaaaaggattgccttatttaaaagattttaatttggcttaa

DBGET integrated database retrieval system