KEGG   Riemerella anatipestifer RA-CH-1: B739_1344Help
Entry
B739_1344         CDS       T02331                                 

Definition
6-phosphofructokinase
Orthology
K00850  
6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
rag  Riemerella anatipestifer RA-CH-1
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:rag00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    B739_1344
   01230 Biosynthesis of amino acids
    B739_1344
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    B739_1344
   00030 Pentose phosphate pathway
    B739_1344
   00051 Fructose and mannose metabolism
    B739_1344
   00052 Galactose metabolism
    B739_1344
  Energy metabolism
   00680 Methane metabolism
    B739_1344
Enzymes [BR:rag01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     B739_1344
Protein phosphatases and associated proteins [BR:rag01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     B739_1344
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1429511..1430482
Genome map
AA seq 323 aa AA seqDB search
MKRIGVLTSGGDSPGMNAAIRAVVRTAHYYGIECMGIREGYNGLIEGNMIKMGPRSVKNI
INQGGTILKSARSKEFRTVEGRLKAFEQCQKHEIGALVCIGGDGTFTGAKVFNEEHGIKV
VGVPGTIDNDIFGTDFTIGYDTALNTAVEAIDKIRDTATSHNRVFFVEVMGRDAGFIALN
SGIASGAIDILIPEKKDSLEEMFENFHNAQKRGKTSSIVVVAEGEQLASTYELAEKTQKE
FPDYDIRVAILGHIQRGGMPSCADRVLASRLGYGAVEGLRKGLTNVMAGIRANQLVFTPI
EDAIRKHNEINQDLLKISEILAM
NT seq 972 nt NT seq  +upstreamnt  +downstreamnt
ttgaaaaggataggagttcttacttctggaggggattctccaggtatgaatgcggcgata
agggcagtggtaagaacagctcattattatggtatagaatgtatggggattagagaaggg
tacaatgggcttatagaagggaacatgattaaaatgggacctaggtctgttaagaatatt
attaaccaaggtggtacaattctaaaatcagcaaggtctaaagagtttagaacggtggaa
ggtagactaaaggcttttgaacaatgccaaaagcatgaaattggagctttggtttgtatt
ggtggagatggtacttttacaggagcaaaagttttcaacgaagagcatggtatcaaggtt
gtgggtgtacctggaactattgataatgatatcttcggtacagattttacaataggctat
gacacggctcttaacacggcggtggaagctatagacaaaataagagatacggcaacctct
cacaacagagtgttttttgtggaagtgatggggagagatgcaggttttatagcacttaat
agtggtattgcttcaggagctatagatattttgataccagaaaaaaaggatagcctagag
gaaatgtttgagaatttccataatgctcaaaaacgaggcaaaacatcgtctattgttgtg
gtagcagagggggaacagttggcttctacctatgagttagctgagaaaactcaaaaagaa
ttccctgattatgacatcagagtggctattctaggacacatacaaagaggtggaatgcct
agctgtgctgatagagtgctggcgagtagattagggtatggcgcggtagaagggcttaga
aaaggtcttactaatgtgatggcaggtataagagccaatcagttagtttttaccccaata
gaagatgctattagaaagcacaacgaaatcaatcaagatttactgaagatatcagaaatt
ttggcgatgtaa

DBGET integrated database retrieval system