KEGG   Riemerella anatipestifer RA-CH-1: B739_1344Help
Entry
B739_1344         CDS       T02331                                 

Definition
6-phosphofructokinase
Orthology
K00850  
6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
rag  Riemerella anatipestifer RA-CH-1
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Class
Metabolism; Overview; Carbon metabolism [PATH:rag01200]
Metabolism; Overview; Biosynthesis of amino acids [PATH:rag01230]
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:rag00010]
Metabolism; Carbohydrate metabolism; Pentose phosphate pathway [PATH:rag00030]
Metabolism; Carbohydrate metabolism; Fructose and mannose metabolism [PATH:rag00051]
Metabolism; Carbohydrate metabolism; Galactose metabolism [PATH:rag00052]
Metabolism; Energy metabolism; Methane metabolism [PATH:rag00680]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1429511..1430482
Genome map
AA seq 323 aa AA seqDB search
MKRIGVLTSGGDSPGMNAAIRAVVRTAHYYGIECMGIREGYNGLIEGNMIKMGPRSVKNI
INQGGTILKSARSKEFRTVEGRLKAFEQCQKHEIGALVCIGGDGTFTGAKVFNEEHGIKV
VGVPGTIDNDIFGTDFTIGYDTALNTAVEAIDKIRDTATSHNRVFFVEVMGRDAGFIALN
SGIASGAIDILIPEKKDSLEEMFENFHNAQKRGKTSSIVVVAEGEQLASTYELAEKTQKE
FPDYDIRVAILGHIQRGGMPSCADRVLASRLGYGAVEGLRKGLTNVMAGIRANQLVFTPI
EDAIRKHNEINQDLLKISEILAM
NT seq 972 nt NT seq  +upstreamnt  +downstreamnt
ttgaaaaggataggagttcttacttctggaggggattctccaggtatgaatgcggcgata
agggcagtggtaagaacagctcattattatggtatagaatgtatggggattagagaaggg
tacaatgggcttatagaagggaacatgattaaaatgggacctaggtctgttaagaatatt
attaaccaaggtggtacaattctaaaatcagcaaggtctaaagagtttagaacggtggaa
ggtagactaaaggcttttgaacaatgccaaaagcatgaaattggagctttggtttgtatt
ggtggagatggtacttttacaggagcaaaagttttcaacgaagagcatggtatcaaggtt
gtgggtgtacctggaactattgataatgatatcttcggtacagattttacaataggctat
gacacggctcttaacacggcggtggaagctatagacaaaataagagatacggcaacctct
cacaacagagtgttttttgtggaagtgatggggagagatgcaggttttatagcacttaat
agtggtattgcttcaggagctatagatattttgataccagaaaaaaaggatagcctagag
gaaatgtttgagaatttccataatgctcaaaaacgaggcaaaacatcgtctattgttgtg
gtagcagagggggaacagttggcttctacctatgagttagctgagaaaactcaaaaagaa
ttccctgattatgacatcagagtggctattctaggacacatacaaagaggtggaatgcct
agctgtgctgatagagtgctggcgagtagattagggtatggcgcggtagaagggcttaga
aaaggtcttactaatgtgatggcaggtataagagccaatcagttagtttttaccccaata
gaagatgctattagaaagcacaacgaaatcaatcaagatttactgaagatatcagaaatt
ttggcgatgtaa

DBGET integrated database retrieval system