KEGG   Riemerella anatipestifer RA-CH-1: B739_1395Help
Entry
B739_1395         CDS       T02331                                 

Definition
hypothetical protein
Orthology
K00950  
2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase [EC:2.7.6.3]
Organism
rag  Riemerella anatipestifer RA-CH-1
Pathway
Folate biosynthesis
Metabolic pathways
Module
Tetrahydrofolate biosynthesis, GTP => THF
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:rag00790]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1478280..1478729
Genome map
AA seq 149 aa AA seqDB search
MSQRKVILLLGSNIKNPKKNIEEAILLINRHLGNVIKKSKMLETEPVEFVSSNNFCNIAL
SLETDFSPIQILKKAKEIERYMGRVLDSRDLGGYEDRVIDVDIVAIGNLSYQSKMLNLPH
HRHLFVRNFSREILEDLGENIEKYKNIQI
NT seq 450 nt NT seq  +upstreamnt  +downstreamnt
atgtcgcaaagaaaggtcattttgttactaggaagcaatataaaaaatcctaaaaaaaat
atagaagaagctattttattgataaacaggcatctggggaatgtaataaaaaagagtaaa
atgctagaaacagagcctgtggagtttgttagttctaataatttttgtaatattgcactc
tcgttggagactgatttttcgcctattcaaattttgaagaaagcaaaagaaatagaaagg
tatatgggaagggttcttgattctagggatttgggaggttatgaagatagagttatagat
gttgatatagttgccataggcaatctttcgtatcagtcaaaaatgttaaatttaccccat
cataggcatctttttgtgcgtaatttttctagggaaattctagaagatttgggagagaat
attgaaaaatataaaaacattcaaatatga

DBGET integrated database retrieval system