KEGG   Riemerella anatipestifer RA-CH-1: B739_1430Help
Entry
B739_1430         CDS       T02331                                 

Definition
hypothetical protein
Orthology
K01077  
alkaline phosphatase [EC:3.1.3.1]
Organism
rag  Riemerella anatipestifer RA-CH-1
Pathway
Folate biosynthesis
Metabolic pathways
Microbial metabolism in diverse environments
Two-component system
Module
Tetrahydrofolate biosynthesis, GTP => THF
Brite
KEGG Orthology (KO) [BR:rag00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    B739_1430
  Xenobiotics biodegradation and metabolism
   00627 Aminobenzoate degradation
    B739_1430
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    B739_1430
Enzymes [BR:rag01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.1  alkaline phosphatase
     B739_1430
Exosome [BR:rag04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   B739_1430
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1516651..1518063
Genome map
AA seq 470 aa AA seqDB search
MKRRDFLKSGSIAALGSMLISPFGLKANTIKEEFGGKKAKNIIFMVSDGMSVGTLHMADI
YSRRKLGRASHWLSLYENNLVQRAMMDMASASSIVTDSAAASSSWGGGVRVNNGSLNISP
DGKENMPILQKFKKAGKKVGCVTTVPINHATPAGFCVTSKKRSAMDDIAMDYLDLGFDVM
MGGGTKYFEADKRKDAVDLDAKFRSKGYTVVKNKAEMLSAPKNKPILGTFDEEALPYTVD
HNSCDKMKANIPTLAEMTEKAISQMKDHPKGFVMQVEGGKVDWAAHGNDVAALLYDQLAF
DEAVKVAIDFAKKDGNTLVVITSDHGNANPGLIYGKTCNDNFDHIQNFKNSNEWILQGIQ
PDSTVSFVKERIAKACGDMVLSDDQAKQLLSYYSKAKQEDGLYNPRHLPFKLLSEMQKDY
TSVGWISMDHSSDYTELAMFGPGSERLKPLMRNTDIHTFLLDAAEVENKF
NT seq 1413 nt NT seq  +upstreamnt  +downstreamnt
atgaaaagaagagattttttaaagagcgggtctatagcggctttaggaagtatgcttatc
agtccgtttggtttaaaagccaatacgataaaagaagaatttggagggaaaaaagccaaa
aacatcatctttatggtgagtgatggtatgagcgtggggaccctacatatggcagatatt
tactctagaagaaaattaggtagagcttctcattggcttagtttgtacgaaaataattta
gtacaaagagcgatgatggatatggcatcggcgagttctattgttaccgattctgcggca
gcaagttcttcgtggggtgggggagtgcgtgtaaataacgggagtcttaacattagccca
gatggaaaagaaaatatgccgatactccaaaagtttaaaaaggcaggtaaaaaggtaggt
tgtgtaactacggttcctatcaaccacgctacaccagcggggttttgtgtaacttctaaa
aagagaagtgcgatggatgatattgcgatggactatttagatttaggttttgatgtgatg
atgggaggaggaactaaatattttgaagcagataagaggaaagacgctgtagatttagat
gctaagtttcgttccaaaggttatacagtggtgaaaaacaaagcagaaatgttatctgct
cctaaaaataaacctatcctaggtacttttgatgaggaggcattgccctatactgtagac
cataatagctgtgataaaatgaaagccaatatccctactttggcagagatgacggagaag
gctatatcgcagatgaaagaccaccctaaaggctttgtaatgcaagtagaaggcggtaag
gtggactgggcggcacacggtaatgatgtggcggctctgctatacgaccagttggctttt
gatgaggcggtgaaggtcgctatagattttgcaaagaaagacggtaatactttagtggta
attacttctgaccacggaaatgccaacccagggcttatctatggtaaaacttgtaatgat
aattttgaccatatacaaaactttaaaaactctaacgaatggatattgcaagggatacag
cctgatagcactgtttctttcgttaaagagagaatagccaaggcgtgtggagatatggtg
ttgtctgatgaccaagcgaagcagctattatcctactactctaaagcaaagcaagaagat
ggtttgtataaccctcgccacttgccgtttaagctcctttccgagatgcaaaaagactat
acctctgtggggtggataagtatggaccactcctcggactatacagaacttgcgatgttt
ggaccaggaagcgaacgcctaaaaccgctgatgagaaatacagatatacacacattctta
ctagacgctgctgaagtagaaaataagttttag

DBGET integrated database retrieval system