KEGG   Riemerella anatipestifer RA-CH-1: B739_1568Help
Entry
B739_1568         CDS       T02331                                 

Definition
aspartate carbamoyltransferase catalytic subunit
Orthology
K00609  
aspartate carbamoyltransferase catalytic subunit [EC:2.1.3.2]
Organism
rag  Riemerella anatipestifer RA-CH-1
Pathway
Pyrimidine metabolism
Alanine, aspartate and glutamate metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:rag00001]
 Metabolism
  Nucleotide metabolism
   00240 Pyrimidine metabolism
    B739_1568
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    B739_1568
Enzymes [BR:rag01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.3  Carboxy- and carbamoyltransferases
    2.1.3.2  aspartate carbamoyltransferase
     B739_1568
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1649674..1650570
Genome map
AA seq 298 aa AA seqDB search
MLTISDLSTEKIRSLLEEAQGFANGRIVKCQQEVYVSNLFFENSTRTKTSFDVAERKLGL
NVVPFDVSTSSVNKGETLYDTVKTLESIGIDLVVIRHSQDFYFRELETINIPIINGGDGT
GNHPSQSLLDLMTIYQEFKKFEGLKVGIVGDVKHSRVANSNAEALRRLGAKVYFSGPEEW
FDEAEFINGTYLPIDTLVKEVDVVMLLRIQHERHGERMKLSLDKYHQKYGLTKERAAKMK
PTSIIMHPAPINRGVEIESDLVESPQSRIFKQMENGVYARMAILKQALEDKGVMFKTI
NT seq 897 nt NT seq  +upstreamnt  +downstreamnt
atgcttacaatttcagatttatctacagagaaaattaggtctcttttggaggaggcgcaa
gggtttgccaatggtagaatagttaaatgtcaacaagaagtttatgtgtctaatcttttc
tttgaaaacagtacgagaaccaaaacaagttttgatgtagccgaaaggaaattaggactc
aatgtggtgccttttgatgtctctacaagttcggtaaacaaaggcgaaacgctttacgat
acggtaaaaactttggaaagtattgggattgatttggtagtcattcgccatagtcaggat
ttttattttagggagttggagactattaacattcctataattaacggaggagatggcaca
ggcaatcacccttcgcaatctttgttggatttaatgacgatttatcaagaatttaaaaag
tttgaaggattaaaagtggggattgtaggcgatgttaaacacagcagagtggctaactca
aatgcggaggcactaagaaggctcggggctaaagtctacttttcgggaccagaagaatgg
ttcgacgaggctgaatttatcaatgggacttatctgcctatagatacgcttgtaaaagag
gtcgatgtggtgatgcttcttcgcattcagcacgaaagacacggagagagaatgaaactc
tctttggacaaataccaccaaaaatatggtcttactaaagagagagctgctaaaatgaaa
ccaacttctatcattatgcacccagctcctatcaatagaggagtggaaatagagtcggat
ttggtggaaagccctcaatccagaatatttaagcaaatggaaaacggcgtttacgcccga
atggcaatcctaaaacaggctttggaagacaaaggagtgatgtttaaaacaatataa

  All links  
No link information was found.   
DBGET integrated database retrieval system