KEGG   Riemerella anatipestifer RA-CH-1: B739_1612Help
Entry
B739_1612         CDS       T02331                                 

Definition
Pyruvate/2-oxoglutarate dehydrogenase complex, dihydrolipoamide acyltransferase (E2) component,-related enzyme
Orthology
K00658  
2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
rag  Riemerella anatipestifer RA-CH-1
Pathway
Citrate cycle (TCA cycle)
Lysine degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:rag00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    B739_1612
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    B739_1612
  Amino acid metabolism
   00310 Lysine degradation
    B739_1612
Enzymes [BR:rag01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.61  dihydrolipoyllysine-residue succinyltransferase
     B739_1612
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1695845..1697077
Genome map
AA seq 410 aa AA seqDB search
MSILEMKVPSPGESITEVEIATWLVQDGDYVEKDQPIAEVDSDKATLELPAEESGIITLK
AEEGDVVEVGQVVCLIDMSAAKPEGGAAKQETAKVEEKKEEVKAEAPKQEASPATYATGT
PSPAAKKILDEKGVEASQVKGTGRDGRITKEDAEQASVPAMGSVFATNGSRSSKTTKLSS
LRRKLAQRLVSVKNETAMLTTFNEVDMSEIFRIRKQYKEEFAAKHGVGLGFMSFFTKAVT
RALQMYPEVNSMIDGNQMITYDFCDVSVAVSGPKGLMVPVLRNAETMSFRGVEASIKELA
EKARNGKITVDEMTGGTFTITNGGVFGSMLSTPIINPPQSAILGMHNIIQRPVAVDGQVV
IRPMMYLALSYDHRIIDGRESVGFLVAVKEAIDNPVEHLLGGDERRGLEL
NT seq 1233 nt NT seq  +upstreamnt  +downstreamnt
atgtcaatattagaaatgaaagttccctctccgggagagtctattacagaagtagaaatc
gctacttggttggttcaagatggtgattatgtagaaaaagatcagcctattgcagaagta
gattctgataaggcaacgctagaacttccagctgaagaaagtggtatcattacgctaaag
gcagaagaaggcgacgtagtagaagtaggacaagtggtttgtctaattgatatgagtgcg
gctaaaccagaaggtggtgcagctaagcaagagactgctaaagtagaagaaaagaaagaa
gaagttaaagcagaagctccaaaacaagaggcttctcctgcaacctatgctacaggaaca
ccgtctcctgcagctaagaaaattctagatgagaaaggggtagaggcatctcaagtaaaa
ggaacaggtagagatggtagaattactaaagaagatgcagaacaggcttctgtaccggct
atgggttctgtatttgctactaatgggtctagatcttctaagacaactaaattatcttca
ttgagaagaaaattagctcagcgtttagtttctgttaagaatgaaacggcgatgcttact
actttcaatgaggtagatatgagtgagattttcagaattagaaaacaatataaagaggag
tttgcagcgaagcacggtgtaggtttaggctttatgtctttctttacaaaggcggttact
agagcgttacaaatgtatccagaggtaaactctatgatagacggcaatcaaatgattact
tatgatttctgcgatgtttctgtggcggtatctggtcctaaagggcttatggttcctgta
cttagaaatgcagaaacaatgtctttccgtggtgtagaggctagcattaaggaactagca
gagaaggcaagaaacgggaaaattacggtagatgaaatgacaggaggaacttttactatc
actaatggtggggtatttgggtctatgctttcaacacctattatcaatccgcctcaatct
gcaattttaggaatgcacaacattatccaaagaccagtggcagtagatggacaagtggtt
attcgtccaatgatgtatctagcattatcttatgaccatagaattatagacggaagagaa
tctgtaggtttcttagtagcggtaaaagaagctattgataatcctgtagaacatttgcta
ggaggtgatgaaagaagaggattagaactttag

DBGET integrated database retrieval system