KEGG   Riemerella anatipestifer RA-CH-1: B739_1746Help
Entry
B739_1746         CDS       T02331                                 

Definition
protein-L-isoaspartate carboxylmethyltransferase
Orthology
K00573  
protein-L-isoaspartate(D-aspartate) O-methyltransferase [EC:2.1.1.77]
Organism
rag  Riemerella anatipestifer RA-CH-1
Brite
Enzymes [BR:rag01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.77  protein-L-isoaspartate(D-aspartate) O-methyltransferase
     B739_1746
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1828842..1829495
Genome map
AA seq 217 aa AA seqDB search
MKDTFVHKGKRKILVEYLREKLGICDENVLSAIGALPRHFFMESVFEDYAYEDRAFPIAA
HQTISHPSTVAEQTELLQVEKGEKILEIGTGSGYQAAVLMVMGAKVYTIERQKKLFDFSK
KMFKILGLRPHFQSFGDGFLGLPTFAPFDKIIVTCGAETLPVELLKQLKVGGKMVIPLGA
LEEQILYRFTKISETEIEKETFGVYKFVPMLGDTDCV
NT seq 654 nt NT seq  +upstreamnt  +downstreamnt
atgaaagatacatttgtacataaaggaaaacggaaaatactggtagaatatctaagagaa
aaactgggtatttgtgatgaaaatgtgctgtcagcgataggagcattgcctcgtcatttt
tttatggaaagtgtttttgaggattatgcttacgaagatagagcttttcctattgctgca
catcagactatttcccatccttctactgtggcagaacaaactgagttattacaggtagaa
aaaggtgaaaaaatattagaaataggtacaggtagcggctatcaagcagcggttcttatg
gtgatgggagctaaagtttacactattgaaagacagaaaaagttatttgatttttctaaa
aagatgtttaaaattttgggacttcgtccacattttcaaagttttggagatggtttttta
ggattgcctacttttgctccgtttgataaaattattgtaacctgcggagctgaaactttg
cctgtggaattattaaagcagcttaaagtaggtggcaaaatggtcattccgctaggggct
ttagaagagcagatactttatagatttaccaaaatttctgaaacagaaatagaaaaggaa
acttttggagtgtataagtttgttccaatgttaggagatacagattgtgtttaa

DBGET integrated database retrieval system