KEGG   Riemerella anatipestifer RA-CH-1: B739_1747Help
Entry
B739_1747         CDS       T02331                                 

Definition
Pyruvate/2-oxoglutarate dehydrogenase complex, dihydrolipoamide acyltransferase (E2) component,-related enzyme
Orthology
K00658  
2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
rag  Riemerella anatipestifer RA-CH-1
Pathway
Citrate cycle (TCA cycle)
Lysine degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Class
Metabolism; Overview; Carbon metabolism [PATH:rag01200]
Metabolism; Carbohydrate metabolism; Citrate cycle (TCA cycle) [PATH:rag00020]
Metabolism; Amino acid metabolism; Lysine degradation [PATH:rag00310]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1829558..1830895
Genome map
AA seq 445 aa AA seqDB search
MLKTNKTMAEYKLLLPSMGEGVMEATIISWLFDEGDFVNEDDSVVEIATDKVDSDVPTPV
SGKIVKILKQKDEVAQVGEAIAILETEGGSAVSDTTQEAPKVVETVEEAPSADVIKTIEA
PLNESKVEFSGDLYLSPLVKSIAQEENISEAELKTIKGTGLEGRITKEDILKYVENRGQS
SSSVMKQEVPQVVVPSSASAIPSVPVGTSEGDEVIPMDRVRKIIADSMVRSKHTAPHVSS
FIESDVTNVVKWRNKYKNIFQQREGEKLTFMPIFVRAVVKAIQDYPMINVSVDGDKIIKK
KNINIGMATALPDGNLIVPVIKNADQLSLSGLAKAINDLAHRARSKKLKPEDTQGATYTI
SNIGSFGNLMGTPIIPLPQVAILAVGAIVKKPAVLETPEGDVIAIRQKMFMSHSYDHRVV
DGSLGGMFLKAVHDYLENWDLDTEI
NT seq 1338 nt NT seq  +upstreamnt  +downstreamnt
ttgctaaaaaccaataaaacaatggcagaatataaattattacttccttcaatgggagaa
ggcgttatggaagcaactattatttcttggctatttgatgagggtgacttcgtaaacgag
gatgatagtgtagtggaaatagcaacagacaaagtagattcagatgtacctactcctgtt
tcggggaagattgttaaaattttaaaacaaaaagacgaagtagcacaagtaggagaggct
attgcgatattagaaacagaaggtggaagtgcagtatcagatactactcaagaagcacca
aaagtagttgaaacggtagaagaagctcctagtgctgatgttataaaaacaatagaagca
cctctaaatgagtcgaaggtagagttttcaggagatttatatttgtcgcctttagtgaaa
tctattgctcaggaagaaaatatttcggaagctgaattaaaaaccataaaaggaacaggt
ctagaaggtagaattactaaagaagacatattaaaatatgtggagaatagaggtcaatct
tcgtcatctgttatgaagcaggaagtgcctcaggtggtagtacctagtagtgcgtctgcg
ataccttctgtacccgtaggtacttctgaaggagacgaagtgataccaatggatagagtt
agaaaaattattgctgattctatggtgcgtagtaaacacacggctcctcacgtaagttcg
tttattgagagtgatgttactaatgttgtaaaatggagaaataagtataaaaatattttc
caacaaagagaaggcgaaaagctgacttttatgcctatttttgtaagagcggtagtgaag
gctattcaagattatccaatgattaatgtttctgtagatggggacaaaatcattaagaag
aaaaatatcaatataggtatggcaacggctttaccagacggaaaccttattgtacctgta
attaaaaatgcagaccaattatcgttaagtggtttagctaaagctatcaatgatttggct
catcgtgcgagaagcaaaaaactaaaaccagaagatactcaaggcgctacttatactatt
tctaatattggttcttttggtaatttaatggggacgccaattattcctctgcctcaagtg
gctattttagcagtaggagctattgttaaaaaacctgcggtactggaaactccagagggt
gatgtaatagcaattagacagaaaatgtttatgagccactcttatgaccaccgtgtggta
gatggttctctaggtggaatgttcttaaaagcggttcacgattatctagagaattgggat
ttggatacagaaatctaa

DBGET integrated database retrieval system