KEGG   Riemerella anatipestifer RA-CH-1: B739_1747Help
Entry
B739_1747         CDS       T02331                                 

Definition
(RefSeq) Pyruvate/2-oxoglutarate dehydrogenase complex, dihydrolipoamide acyltransferase (E2) component,-related enzyme
  KO
K00658  
2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
rag  Riemerella anatipestifer RA-CH-1
Pathway
Citrate cycle (TCA cycle)
Lysine degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Module
Citrate cycle (TCA cycle, Krebs cycle)
Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:rag00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    B739_1747
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    B739_1747
  Amino acid metabolism
   00310 Lysine degradation
    B739_1747
Enzymes [BR:rag01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.61  dihydrolipoyllysine-residue succinyltransferase
     B739_1747
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1829558..1830895
Genome map
AA seq 445 aa AA seqDB search
MLKTNKTMAEYKLLLPSMGEGVMEATIISWLFDEGDFVNEDDSVVEIATDKVDSDVPTPV
SGKIVKILKQKDEVAQVGEAIAILETEGGSAVSDTTQEAPKVVETVEEAPSADVIKTIEA
PLNESKVEFSGDLYLSPLVKSIAQEENISEAELKTIKGTGLEGRITKEDILKYVENRGQS
SSSVMKQEVPQVVVPSSASAIPSVPVGTSEGDEVIPMDRVRKIIADSMVRSKHTAPHVSS
FIESDVTNVVKWRNKYKNIFQQREGEKLTFMPIFVRAVVKAIQDYPMINVSVDGDKIIKK
KNINIGMATALPDGNLIVPVIKNADQLSLSGLAKAINDLAHRARSKKLKPEDTQGATYTI
SNIGSFGNLMGTPIIPLPQVAILAVGAIVKKPAVLETPEGDVIAIRQKMFMSHSYDHRVV
DGSLGGMFLKAVHDYLENWDLDTEI
NT seq 1338 nt NT seq  +upstreamnt  +downstreamnt
ttgctaaaaaccaataaaacaatggcagaatataaattattacttccttcaatgggagaa
ggcgttatggaagcaactattatttcttggctatttgatgagggtgacttcgtaaacgag
gatgatagtgtagtggaaatagcaacagacaaagtagattcagatgtacctactcctgtt
tcggggaagattgttaaaattttaaaacaaaaagacgaagtagcacaagtaggagaggct
attgcgatattagaaacagaaggtggaagtgcagtatcagatactactcaagaagcacca
aaagtagttgaaacggtagaagaagctcctagtgctgatgttataaaaacaatagaagca
cctctaaatgagtcgaaggtagagttttcaggagatttatatttgtcgcctttagtgaaa
tctattgctcaggaagaaaatatttcggaagctgaattaaaaaccataaaaggaacaggt
ctagaaggtagaattactaaagaagacatattaaaatatgtggagaatagaggtcaatct
tcgtcatctgttatgaagcaggaagtgcctcaggtggtagtacctagtagtgcgtctgcg
ataccttctgtacccgtaggtacttctgaaggagacgaagtgataccaatggatagagtt
agaaaaattattgctgattctatggtgcgtagtaaacacacggctcctcacgtaagttcg
tttattgagagtgatgttactaatgttgtaaaatggagaaataagtataaaaatattttc
caacaaagagaaggcgaaaagctgacttttatgcctatttttgtaagagcggtagtgaag
gctattcaagattatccaatgattaatgtttctgtagatggggacaaaatcattaagaag
aaaaatatcaatataggtatggcaacggctttaccagacggaaaccttattgtacctgta
attaaaaatgcagaccaattatcgttaagtggtttagctaaagctatcaatgatttggct
catcgtgcgagaagcaaaaaactaaaaccagaagatactcaaggcgctacttatactatt
tctaatattggttcttttggtaatttaatggggacgccaattattcctctgcctcaagtg
gctattttagcagtaggagctattgttaaaaaacctgcggtactggaaactccagagggt
gatgtaatagcaattagacagaaaatgtttatgagccactcttatgaccaccgtgtggta
gatggttctctaggtggaatgttcttaaaagcggttcacgattatctagagaattgggat
ttggatacagaaatctaa

DBGET integrated database retrieval system