KEGG   Riemerella anatipestifer RA-CH-1: B739_1852Help
Entry
B739_1852         CDS       T02331                                 

Definition
Indole-3-glycerol phosphate synthase
Orthology
K01609  
indole-3-glycerol phosphate synthase [EC:4.1.1.48]
Organism
rag  Riemerella anatipestifer RA-CH-1
Pathway
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:rag01230]
Metabolism; Amino acid metabolism; Phenylalanine, tyrosine and tryptophan biosynthesis [PATH:rag00400]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1932709..1933485
Genome map
AA seq 258 aa AA seqDB search
MTILDKIVNYKQEEIQQAKKQTPLEKLKDTPFFHQPTRGFIESLKSNPYGIIAEFKRKSP
SKNNINIEAKIQEVLPLYKEYGAACVSVLTDTSFFGGSLTDLEEANAYNIPLLRKDFIVD
DYQIYQAKAHGADCILLIANILAKSQIEDLTDTAHHLGLDVLLEFYSGEDFDKYYSKLKM
VGINNRNLNTFEVDYEHAIRMRNQLPEGTLGVAESAIYSSEIYKKLKHNGFDAFLMGEYF
MKQNHIGMALQSFIEEIK
NT seq 777 nt NT seq  +upstreamnt  +downstreamnt
atgaccatattagacaaaatagtaaattacaaacaggaagaaatccaacaagcaaaaaag
caaacaccattagaaaagctcaaggatactccgttttttcaccagcctacacgaggtttt
attgagagtttaaagtccaatccatacgggattatagccgagtttaaaaggaaatcgccc
tccaaaaataacatcaacatagaagctaaaatccaagaggttttaccgctatataaggaa
tacggagcagcttgtgtgtctgtattgacggatacgtcttttttcgggggaagtttaacc
gatttggaagaagccaatgcttacaatatacctttgctaaggaaagactttattgtcgat
gattatcaaatttatcaagccaaagcccacggtgcagactgtattttacttatagccaac
attttggctaaatcccagattgaagaccttacagatacggcacaccacttgggattagat
gtgttattggaattttatagtggtgaagattttgataaatattattccaaattaaaaatg
gtaggtattaacaaccgaaatctcaatacttttgaagtagattacgaacacgctattaga
atgcgaaaccaactgcctgaaggaactttaggcgttgccgaaagtgccatttatagctct
gaaatttataaaaaactaaaacacaatggctttgacgctttcttgatgggcgaatatttt
atgaaacaaaaccatattggaatggctttacaatcttttattgaagaaataaaataa

DBGET integrated database retrieval system