KEGG   Riemerella anatipestifer RA-CH-1: B739_1885Help
Entry
B739_1885         CDS       T02331                                 

Definition
recombinational DNA repair protein (RecF pathway)
Orthology
K06187  
recombination protein RecR
Organism
rag  Riemerella anatipestifer RA-CH-1
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:rag00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    B739_1885
DNA repair and recombination proteins [BR:rag03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   NHEJ (non-homologous end-joining)
    SHDIR (short-homology-dependent illegitimate recombination)
     RecET pathway
      B739_1885
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1970904..1971512)
Genome map
AA seq 202 aa AA seqDB search
MNFPSKVLEKAVEEISGLPGIGRKSALRLALHLLRQPSSQGLALGEAIQNLVTEIKYCKE
CHNFSDTDICEICADDSRHAELLCVVEDVRDVMAIENTGKFKGKYLVLGGKISPMEGIGP
QQLNIETLESKLEIGEIEEVIFALSATMEGDTTVYYLYKKFKHFDIKFSNIARGISVGDE
LEYADEVSLGRSILNRIPYKGH
NT seq 609 nt NT seq  +upstreamnt  +downstreamnt
atgaattttccaagtaaggttttagaaaaggcagtagaagaaatatcgggacttccaggg
ataggtagaaaatcagctcttaggttagctcttcatttgcttagacaacctagttcacaa
gggctagctctaggtgaggctatacaaaatctagttacagagataaaatactgtaaagaa
tgccataacttttcggacacagatatttgcgaaatttgtgcagatgacagtagacacgct
gaactcctatgcgttgtggaagatgtgagagatgtaatggcgatagaaaatacagggaaa
ttcaaagggaaatatttggttctaggagggaaaatatcacctatggaaggcattggtcct
caacaattaaatatagaaaccctagaaagcaaactagaaataggggagatagaggaggtt
atttttgcactatctgccactatggagggcgataccaccgtgtattatttgtataaaaag
tttaagcattttgacattaaattctccaatattgcaagagggatttccgtaggagatgaa
ctagagtacgccgatgaagtttctttggggaggtctattttgaaccgaataccttataaa
ggtcattaa

DBGET integrated database retrieval system